(data stored in ACNUC30630 zone)

EMBL: BX251410.RPLE

BX251410.RPLE        Location/Qualifiers
FT   CDS             249622..250173
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="TW219"
FT                   /product="50S ribosomal protein L5"
FT                   /note="Similar to Escherichia coli 50s ribosomal protein L5
FT                   RplE or b3308 or z4678 or ecs4173 SWALL:RL5_ECOLI
FT                   (SWALL:P02389) (178 aa) fasta scores: E(): 1.3e-37, 54.23%
FT                   id in 177 aa"
FT                   /db_xref="GOA:Q83I66"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I66"
FT                   /protein_id="CAD66896.1"
FT                   /translation="MTCYTPRLLTRYREEIVPVLMSRFDINNVHQVPSITKIVVNSGVG
FT                   DAARDSKIIEGAVSDITLITGQKPRINRAKQSIAKFKLREGQAVGVTATLRGRRMWEFL
FT                   DRLLTLALPRIRDFRGISDKQFDGHGNYTFGLSEQGIFHEIDQDKIDRVRGMDITVVTT
FT                   SSSDDMARALLGELGFPFKK"
     MTCYTPRLLT RYREEIVPVL MSRFDINNVH QVPSITKIVV NSGVGDAARD SKIIEGAVSD        60
     ITLITGQKPR INRAKQSIAK FKLREGQAVG VTATLRGRRM WEFLDRLLTL ALPRIRDFRG       120
     ISDKQFDGHG NYTFGLSEQG IFHEIDQDKI DRVRGMDITV VTTSSSDDMA RALLGELGFP       180
     FKK                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page