(data stored in ACNUC30630 zone)

EMBL: BX251410.RPLF

BX251410.RPLF        Location/Qualifiers
FT   CDS             250595..251140
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="TW221"
FT                   /product="50S ribosomal protein L6"
FT                   /note="Similar to Bacillus stearothermophilus 50s ribosomal
FT                   protein L6 RplF SWALL:RL6_BACST (SWALL:P02391) (177 aa)
FT                   fasta scores: E(): 1.3e-31, 54.8% id in 177 aa"
FT                   /db_xref="GOA:Q83I64"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I64"
FT                   /protein_id="CAD66898.1"
FT                   /translation="MVDMSRVGKLPIEIPVGVEVCVNGRTVSITGPKGSLYLDIAEQIG
FT                   VSVSDGKVLVSRSDDSRTARALHGLTRALIANNVHGVLHGYTKTLEIVGTGYRVSKKGE
FT                   NLELALGFSHPVFVDPVPGVSFGVEGNSKIIVSGIDKQAVGEAAASIRKLSKPEPYKGK
FT                   GIRYSDEIVRRKVGKAGK"
     MVDMSRVGKL PIEIPVGVEV CVNGRTVSIT GPKGSLYLDI AEQIGVSVSD GKVLVSRSDD        60
     SRTARALHGL TRALIANNVH GVLHGYTKTL EIVGTGYRVS KKGENLELAL GFSHPVFVDP       120
     VPGVSFGVEG NSKIIVSGID KQAVGEAAAS IRKLSKPEPY KGKGIRYSDE IVRRKVGKAG       180
     K                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page