(data stored in ACNUC30630 zone)

EMBL: BX251410.RPLI

BX251410.RPLI        Location/Qualifiers
FT   CDS             complement(124733..125194)
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="TW114"
FT                   /product="50s ribosomal protein L9"
FT                   /note="Similar to Streptomyces coelicolor 50s ribosomal
FT                   protein L9 RplI or SCO3909 or SCH24.31 SWALL:RL9_STRCO
FT                   (SWALL:Q9X8U5) (148 aa) fasta scores: E(): 3.6e-21, 44.66%
FT                   id in 150 aa, and to Escherichia coli and Escherichia coli
FT                   O157:H7 50s ribosomal protein l9 RplI or b4203 or z5812 or
FT                   ecs5179 SWALL:RL9_ECOLI (SWALL:P02418) (149 aa) fasta
FT                   scores: E(): 1.6e-11, 39.73% id in 151 aa"
FT                   /db_xref="GOA:Q83IC2"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83IC2"
FT                   /protein_id="CAD66797.1"
FT                   /translation="MTRVILVQDVNGLGSVGDVVEVKAGYSRNYLVPKGMAVRWTEGAQ
FT                   KHIGDISAARRAREAAALQEARDIANTLTKEAVTRELRLAANAGEDGRLFGSVTAANIA
FT                   KVLSSASGHKIDRGKIEIDSPIKTLGEHTVKVKLHPNVKVDINVVVYAE"
     MTRVILVQDV NGLGSVGDVV EVKAGYSRNY LVPKGMAVRW TEGAQKHIGD ISAARRAREA        60
     AALQEARDIA NTLTKEAVTR ELRLAANAGE DGRLFGSVTA ANIAKVLSSA SGHKIDRGKI       120
     EIDSPIKTLG EHTVKVKLHP NVKVDINVVV YAE                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page