(data stored in ACNUC30630 zone)

EMBL: BX251410.RPLM

BX251410.RPLM        Location/Qualifiers
FT   CDS             178288..178713
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="TW153"
FT                   /product="50S ribosomal protein L13"
FT                   /note="Similar to Escherichia coli 50s ribosomal protein
FT                   L13 RplM or b3231 or z4589 or ecs4104 or stm3345 or sty3525
FT                   SWALL:RL13_ECOLI (SWALL:P02410) (142 aa) fasta scores: E():
FT                   3.8e-25, 54.33% id in 127 aa, and to Streptomyces
FT                   coelicolor 50s ribosomal protein L13 RplM or SCO4734 or
FT                   SC6G4.12 SWALL:RL13_STRCO (SWALL:Q53874) (147 aa) fasta
FT                   scores: E(): 3e-29, 52.94% id in 136 aa. N-terminus
FT                   truncated relative to homologues."
FT                   /protein_id="CAD66833.1"
FT                   /translation="MSSKQWVLVDAKDMVLGRLATQVAVLLRGKHRPTYEPHLDTGDCV
FT                   IVVNAALIRVTSNKHAKKVFYTHSGYPGGLKKRGFSDVFQKSPERVLEKAVKGMLPKNK
FT                   LGRSVFRNLRVYPGQDHPHAAQKPSVYAPTRVAQVLV"
     MSSKQWVLVD AKDMVLGRLA TQVAVLLRGK HRPTYEPHLD TGDCVIVVNA ALIRVTSNKH        60
     AKKVFYTHSG YPGGLKKRGF SDVFQKSPER VLEKAVKGML PKNKLGRSVF RNLRVYPGQD       120
     HPHAAQKPSV YAPTRVAQVL V                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page