(data stored in ACNUC30630 zone)

EMBL: BX251410.RPLN

BX251410.RPLN        Location/Qualifiers
FT   CDS             248910..249281
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="TW217"
FT                   /product="50s ribosomal protein L14"
FT                   /note="Similar to Bacillus stearothermophilus 50s ribosomal
FT                   protein L14 RplN SWALL:RL14_BACST (SWALL:P04450) (122 aa)
FT                   fasta scores: E(): 1e-30, 72.35% id in 123 aa"
FT                   /db_xref="GOA:Q83I68"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I68"
FT                   /protein_id="CAD66894.1"
FT                   /translation="MIQQESRLKVADNTGAKSLSVIRVLGGSNRRFGSLGDVVVASVKD
FT                   AVPGSSAVKKGDVVKAVIVRSTKEVRRTDGSYIRFDDNAAVILRPDNDPRGTRIFGPVA
FT                   RELRDRKFTRIISLAPEVV"
     MIQQESRLKV ADNTGAKSLS VIRVLGGSNR RFGSLGDVVV ASVKDAVPGS SAVKKGDVVK        60
     AVIVRSTKEV RRTDGSYIRF DDNAAVILRP DNDPRGTRIF GPVARELRDR KFTRIISLAP       120
     EVV                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page