(data stored in ACNUC30630 zone)

EMBL: BX251410.RPLO

BX251410.RPLO        Location/Qualifiers
FT   CDS             252558..253001
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="TW224"
FT                   /product="50s ribosomal protein L15"
FT                   /note="Similar to Bacillus stearothermophilus 50s ribosomal
FT                   protein L15 RplO SWALL:RL15_BACST (SWALL:P04452) (146 aa)
FT                   fasta scores: E(): 3.1e-15, 44.75% id in 143 aa"
FT                   /db_xref="GOA:Q83I61"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I61"
FT                   /protein_id="CAD66901.1"
FT                   /translation="MRLIKLHHLRPAPGSRRARIRVGRGEGSKGKTAGRGTKGTKARAP
FT                   VRPGFAGGQIPLHMSIPKLKGFKNHKKVEYSVISIKRLCEAYPSGGVVTRDNVMSVIGK
FT                   KRGFVKLLSDGEVTVKFDITVDKASAAAVEKITSAAGTVTQAR"
     MRLIKLHHLR PAPGSRRARI RVGRGEGSKG KTAGRGTKGT KARAPVRPGF AGGQIPLHMS        60
     IPKLKGFKNH KKVEYSVISI KRLCEAYPSG GVVTRDNVMS VIGKKRGFVK LLSDGEVTVK       120
     FDITVDKASA AAVEKITSAA GTVTQAR                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page