(data stored in ACNUC30630 zone)

EMBL: BX251410.RPLP

BX251410.RPLP        Location/Qualifiers
FT   CDS             247898..248329
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="TW214"
FT                   /product="50s ribosomal protein L16"
FT                   /note="Similar to Bacillus subtilis 50s ribosomal protein
FT                   L16 RplP SWALL:RL16_BACSU (SWALL:P14577) (144 aa) fasta
FT                   scores: E(): 2.4e-32, 56.61% id in 136 aa"
FT                   /db_xref="GOA:Q83I71"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I71"
FT                   /protein_id="CAD66891.1"
FT                   /translation="MMLIPKKVKFRKQHRPNRKGMSGCGTRIVFGDYGIQALSRAYVTN
FT                   RQVESARIAMTRHIRRGGRVWINIYPDRPLTKKPAETRMGSGKGSPEYWVANIRPGRIM
FT                   FEVSGVSESLAKEALMRAIHKLPLRARIVERQEFDDAGL"
     MMLIPKKVKF RKQHRPNRKG MSGCGTRIVF GDYGIQALSR AYVTNRQVES ARIAMTRHIR        60
     RGGRVWINIY PDRPLTKKPA ETRMGSGKGS PEYWVANIRP GRIMFEVSGV SESLAKEALM       120
     RAIHKLPLRA RIVERQEFDD AGL                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page