(data stored in ACNUC30630 zone)

EMBL: BX251410.RPLQ

BX251410.RPLQ        Location/Qualifiers
FT   CDS             258010..258549
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="TW233"
FT                   /product="50S ribosomal protein L17"
FT                   /note="Similar to Bacillus stearothermophilus 50s ribosomal
FT                   protein L17 RplQ SWALL:RL17_BACST (SWALL:P07843) (119 aa)
FT                   fasta scores: E(): 3.8e-13, 47.7% id in 109 aa"
FT                   /db_xref="GOA:Q83I55"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I55"
FT                   /protein_id="CAD66910.1"
FT                   /translation="MPKPSRGPRMCSGPDHERLVLANMSASLFLNKKLRTTEARAKRLR
FT                   PFAEKLVTLSKRGGLHSRRRALSILRNKAALHELFTNIAPLVEDRNGGYTRITKVGFRS
FT                   GDGAPMALIELILEPVSARTRGTDTLPDTVIDTGPDSAPDPVPGSEPGSAAGDLPDADT
FT                   APADPGESSSNQRVIR"
     MPKPSRGPRM CSGPDHERLV LANMSASLFL NKKLRTTEAR AKRLRPFAEK LVTLSKRGGL        60
     HSRRRALSIL RNKAALHELF TNIAPLVEDR NGGYTRITKV GFRSGDGAPM ALIELILEPV       120
     SARTRGTDTL PDTVIDTGPD SAPDPVPGSE PGSAAGDLPD ADTAPADPGE SSSNQRVIR        179
//

If you have problems or comments...

PBIL Back to PBIL home page