(data stored in ACNUC30630 zone)

EMBL: BX251410.RPLR

BX251410.RPLR        Location/Qualifiers
FT   CDS             251137..251496
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="TW222"
FT                   /product="50S ribosomal protein L18"
FT                   /note="Similar to Bacillus stearothermophilus 50s ribosomal
FT                   protein L18 RplR SWALL:RL18_BACST (SWALL:P09415) (120 aa)
FT                   fasta scores: E(): 8.7e-20, 52.54% id in 118 aa"
FT                   /db_xref="GOA:Q83I63"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I63"
FT                   /protein_id="CAD66899.1"
FT                   /translation="MSLTSRASARKRRHVRLRKKISGTCDRPRLSVTRSNRHVFVQAVD
FT                   DISGKTLVSASTMEKDIRALELGKTERALAVGKLVAQRALAVGVKSAVFDRGGCKYTGR
FT                   VAAVAEGAREAGLQT"
     MSLTSRASAR KRRHVRLRKK ISGTCDRPRL SVTRSNRHVF VQAVDDISGK TLVSASTMEK        60
     DIRALELGKT ERALAVGKLV AQRALAVGVK SAVFDRGGCK YTGRVAAVAE GAREAGLQT        119
//

If you have problems or comments...

PBIL Back to PBIL home page