(data stored in ACNUC30630 zone)

EMBL: BX251410.RPLV

BX251410.RPLV        Location/Qualifiers
FT   CDS             246877..247236
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="TW212"
FT                   /product="50s ribosomal protein l22"
FT                   /note="Similar to Escherichia coli 50s ribosomal protein
FT                   L22 RplV or EryB or b3315 or z4686 or ecs4180 or stm3435 or
FT                   sty4363 SWALL:RL22_ECOLI (SWALL:P02423) (110 aa) fasta
FT                   scores: E(): 2.2e-13, 45.37% id in 108 aa"
FT                   /db_xref="GOA:Q83I73"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I73"
FT                   /protein_id="CAD66889.1"
FT                   /translation="MSEEKDTPLEAFASLKHSGVTPQKVRRIVDLIRGRSVDEALAILR
FT                   FSPHSASGILYKLIVSAQANYANLLGRDDDLFVSSVYVDEGKTYKRGRPRARGSSSRIL
FT                   KRGSHVTVTLSKEVR"
     MSEEKDTPLE AFASLKHSGV TPQKVRRIVD LIRGRSVDEA LAILRFSPHS ASGILYKLIV        60
     SAQANYANLL GRDDDLFVSS VYVDEGKTYK RGRPRARGSS SRILKRGSHV TVTLSKEVR        119
//

If you have problems or comments...

PBIL Back to PBIL home page