(data stored in ACNUC30630 zone)

EMBL: BX251410.RPLW

BX251410.RPLW        Location/Qualifiers
FT   CDS             245439..245750
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="TW209"
FT                   /product="50s ribosomal protein L23"
FT                   /note="Similar to Mycobacterium bovis 50s ribosomal protein
FT                   L23 RplW SWALL:RL23_MYCBO (SWALL:O06046) (100 aa) fasta
FT                   scores: E(): 8.8e-19, 69.31% id in 88 aa, and to Thermus
FT                   thermophilus ribosomal protein L23 SWALL:Q9RA57
FT                   (EMBL:AF094532) (96 aa) fasta scores: E(): 1.4e-11, 51.76%
FT                   id in 85 aa"
FT                   /protein_id="CAD66886.1"
FT                   /translation="MMRRYSSSVINNKHVHDVILGPAISEKTYGLLEDSKYTFLVDPKS
FT                   NKTEIKLAVEKIFGVKVSSVNTMNRRGKLQRTRKGIGRRKDRKRAVVTLKSGTIDLFT"
     MMRRYSSSVI NNKHVHDVIL GPAISEKTYG LLEDSKYTFL VDPKSNKTEI KLAVEKIFGV        60
     KVSSVNTMNR RGKLQRTRKG IGRRKDRKRA VVTLKSGTID LFT                         103
//

If you have problems or comments...

PBIL Back to PBIL home page