(data stored in ACNUC30630 zone)

EMBL: BX251410.RPLX

BX251410.RPLX        Location/Qualifiers
FT   CDS             249284..249625
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="TW218"
FT                   /product="50S ribosomal protein L24"
FT                   /note="Similar to Bacillus stearothermophilus 50s ribosomal
FT                   protein L24 RplX SWALL:RL24_BACST (SWALL:P04455) (103 aa)
FT                   fasta scores: E(): 1.9e-11, 42.85% id in 112 aa"
FT                   /db_xref="GOA:Q83I67"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I67"
FT                   /protein_id="CAD66895.1"
FT                   /translation="MSVKIRKGDLVQVITGSKTGGKKGKQGRVLAVSGDRVWVEGVNLT
FT                   TRHRKRVTNDKGTSSGGLEKRESPMHISNVALVDPETGAPTKVGFLVKTSGDKTVRVRF
FT                   AKKSGKELT"
     MSVKIRKGDL VQVITGSKTG GKKGKQGRVL AVSGDRVWVE GVNLTTRHRK RVTNDKGTSS        60
     GGLEKRESPM HISNVALVDP ETGAPTKVGF LVKTSGDKTV RVRFAKKSGK ELT              113
//

If you have problems or comments...

PBIL Back to PBIL home page