(data stored in ACNUC30630 zone)

EMBL: BX251410.RPMG

BX251410.RPMG        Location/Qualifiers
FT   CDS             131756..131926
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="TW126"
FT                   /product="50s ribosomal protein L33"
FT                   /note="Similar to Escherichia coli 50s ribosomal protein
FT                   l33 RpmG or b3636 SWALL:RL33_ECOLI (SWALL:P02436) (54 aa)
FT                   fasta scores: E(): 3.6e-07, 43.13% id in 51 aa, and to
FT                   Mycobacterium tuberculosis 50s ribosomal protein l33 type 1
FT                   RpmG or Rv2057c or mt2117.1 or mtcy63a.03 SWALL:R331_MYCTU
FT                   (SWALL:O86356) (54 aa) fasta scores: E(): 3.1e-17, 78.84%
FT                   id in 52 aa"
FT                   /db_xref="GOA:Q83IB5"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83IB5"
FT                   /protein_id="CAD66806.1"
FT                   /translation="MARKRQDVRPIVKLKSTAGTGFTYVTRKNRRNDPDRIVLKKYDPI
FT                   IRRHTEFREER"
     MARKRQDVRP IVKLKSTAGT GFTYVTRKNR RNDPDRIVLK KYDPIIRRHT EFREER            56
//

If you have problems or comments...

PBIL Back to PBIL home page