(data stored in ACNUC30630 zone)

EMBL: BX251410.RPOA

BX251410.RPOA        Location/Qualifiers
FT   CDS             257011..257994
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="TW232"
FT                   /product="DNA-directed RNA polymerase alpha chain"
FT                   /EC_number="2.7.7.6"
FT                   /note="Similar to Streptomyces coelicolor DNA-directed RNA
FT                   polymerase alpha chain RpoA or SCO4729 or SC6G4.07
FT                   SWALL:RPOA_STRCO (SWALL:P72404) (340 aa) fasta scores: E():
FT                   9.7e-75, 63.91% id in 327 aa"
FT                   /db_xref="GOA:Q820D8"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q820D8"
FT                   /protein_id="CAD66909.1"
FT                   /translation="MLIAHRPTLIEKKVSDIRSRFIIEPLEPGFGYTLGNSLRRTLLSS
FT                   IPGAAVTSINIQGVMHEFSTIPGVKEDVTEIVLNVKRLVISSEIDEPFTVRLYKTGEGE
FT                   VLAKDIEVPTGIEIGNGDLVIATLAKDAVFDMQLTIERGRGYVSAEQNRNDGMSLAGHI
FT                   PVDSIYSPVHKVTYRVEATRAGERTDFDRLIIDVETKPSILPRDAVASAGKTLCELFGL
FT                   ARELNSQAEGVEFGVDSMIPESDEDLRIPIEDLGLSVRSYNCLKREGVNYVSELLGFSE
FT                   QELLDIRNFGQKSADEVQEKLAELGHSLKGSVPGFDGSYFDPNYGS"
     MLIAHRPTLI EKKVSDIRSR FIIEPLEPGF GYTLGNSLRR TLLSSIPGAA VTSINIQGVM        60
     HEFSTIPGVK EDVTEIVLNV KRLVISSEID EPFTVRLYKT GEGEVLAKDI EVPTGIEIGN       120
     GDLVIATLAK DAVFDMQLTI ERGRGYVSAE QNRNDGMSLA GHIPVDSIYS PVHKVTYRVE       180
     ATRAGERTDF DRLIIDVETK PSILPRDAVA SAGKTLCELF GLARELNSQA EGVEFGVDSM       240
     IPESDEDLRI PIEDLGLSVR SYNCLKREGV NYVSELLGFS EQELLDIRNF GQKSADEVQE       300
     KLAELGHSLK GSVPGFDGSY FDPNYGS                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page