(data stored in ACNUC30630 zone)

EMBL: BX251410.RPOB

BX251410.RPOB        Location/Qualifiers
FT   CDS             73945..77412
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="TW081"
FT                   /product="DNA-directed RNA polymerase beta chain"
FT                   /EC_number="2.7.7.6"
FT                   /note="Previously sequenced as Tropheryma whipplei
FT                   DNA-directed RNA polymerase beta chain RpoB
FT                   SWALL:RPOB_TROWH (SWALL:Q93GF2) (1216 aa) fasta scores:
FT                   E(): 0, 99.56% id in 1155 aa. Similar to Mycobacterium
FT                   tuberculosis DNA-directed RNA polymerase beta chain RpoB or
FT                   Rv0667 or mt0695 or mtci376.08C SWALL:RPOB_MYCTU
FT                   (SWALL:P47766) (1178 aa) fasta scores: E(): 0, 65.56% id in
FT                   1150 aa"
FT                   /db_xref="GOA:P59642"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/Swiss-Prot:P59642"
FT                   /protein_id="CAD66766.1"
FT                   /translation="MFGVGFLAFAKGKRVCAIGRSSLGKISDPLEVPNLLDLQLDSFDW
FT                   LIGGPRWRAALDAYRKNPSGAPIAEKSGLDEVFDEISPIEDSAGNMQLNFSKPVLEAEE
FT                   LSVRECRVRGRTYSAPLYVEAEFMNHDTGEIKTQTVFMGDFPLMTDKGTFVINGTERVV
FT                   VSQLVRSPGVYFERTPEKNSEKDLFSGRIIPARGAWLEFEVDRHDQLGVRVDRKRRQPV
FT                   IFFLRAIGMTDDEIRDAFGEFESISVQHEKNIGLSRDDALREIYRRVRPGEQASAEAGR
FT                   ALLENFYFTSRRFDLARVGRYKVNRKLGVDVDPTRMVLTRSDIIATIRYLAALHLGFSE
FT                   VAVLNSNKSVPISTDDIDHLGNRRIRPVGELVQNQLRAGLARMERVVRERMTTQDIEAI
FT                   IPQTLINVMPIVAALKEFYGTSQLSQFMDQNNPLAGLTHKRRLSALGPGGLSRERAGVE
FT                   VRDVNPSHYGRMCPIETPEGPNIGLIGSLACYSRVNSFGFIETPYRRVVNGKVTDDIEY
FT                   MTATQEDEHAIAQASTPLRPDNSFVDERVLVRRKGGEVEVVPADQVDYMDVSGRQMVSV
FT                   ATSLIPFLEHNDANRALMGSNMQRQAVPLLVTESPLVGTGMERYVAIDAGDVLIAEDPG
FT                   IVGDVSADVVTVKQDDGKHRDYHVGKFVRSNQGNCYNQRVVVRSGDRVEKGTVLADGPC
FT                   TDKGELSLGRNLLVAFMPWEGYNFEDAIIISQNLVKDDTLSSIHIEEHEVSTRDTKLGS
FT                   EEITRDLPNVSMDYIKDLDERGIIRIGAEVGPGDILVGKVTPKGETELSAEERLLRAIF
FT                   NEKSMEVRDTSLKVPHGQQGTVIDVKLFDAVDGEDKLGAGINQRVVVYIAHKRKITEGD
FT                   KLAGRHGNKGVISKILPVEDMPFMADGTPVDIILNPLGVPARMNFGQVLETHLGWISKQ
FT                   GWKIEGDPDWAKDIRVREAQPDSRVSSPVFDGISEGEITGLFSSVFPNRDGERAVGSDG
FT                   KAILYDGRTGEPFPEPISVGYMYVLKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGG
FT                   QRFGEMEVWALEAYGAAHALQELLTIKSDDVVGRVKVYDAIVKGYPIPTPGVPESFKVI
FT                   VKEMQSLCINIEVVSDGEDDVSADAETLQIEEGLDTSPKVEVGSLEEV"
     MFGVGFLAFA KGKRVCAIGR SSLGKISDPL EVPNLLDLQL DSFDWLIGGP RWRAALDAYR        60
     KNPSGAPIAE KSGLDEVFDE ISPIEDSAGN MQLNFSKPVL EAEELSVREC RVRGRTYSAP       120
     LYVEAEFMNH DTGEIKTQTV FMGDFPLMTD KGTFVINGTE RVVVSQLVRS PGVYFERTPE       180
     KNSEKDLFSG RIIPARGAWL EFEVDRHDQL GVRVDRKRRQ PVIFFLRAIG MTDDEIRDAF       240
     GEFESISVQH EKNIGLSRDD ALREIYRRVR PGEQASAEAG RALLENFYFT SRRFDLARVG       300
     RYKVNRKLGV DVDPTRMVLT RSDIIATIRY LAALHLGFSE VAVLNSNKSV PISTDDIDHL       360
     GNRRIRPVGE LVQNQLRAGL ARMERVVRER MTTQDIEAII PQTLINVMPI VAALKEFYGT       420
     SQLSQFMDQN NPLAGLTHKR RLSALGPGGL SRERAGVEVR DVNPSHYGRM CPIETPEGPN       480
     IGLIGSLACY SRVNSFGFIE TPYRRVVNGK VTDDIEYMTA TQEDEHAIAQ ASTPLRPDNS       540
     FVDERVLVRR KGGEVEVVPA DQVDYMDVSG RQMVSVATSL IPFLEHNDAN RALMGSNMQR       600
     QAVPLLVTES PLVGTGMERY VAIDAGDVLI AEDPGIVGDV SADVVTVKQD DGKHRDYHVG       660
     KFVRSNQGNC YNQRVVVRSG DRVEKGTVLA DGPCTDKGEL SLGRNLLVAF MPWEGYNFED       720
     AIIISQNLVK DDTLSSIHIE EHEVSTRDTK LGSEEITRDL PNVSMDYIKD LDERGIIRIG       780
     AEVGPGDILV GKVTPKGETE LSAEERLLRA IFNEKSMEVR DTSLKVPHGQ QGTVIDVKLF       840
     DAVDGEDKLG AGINQRVVVY IAHKRKITEG DKLAGRHGNK GVISKILPVE DMPFMADGTP       900
     VDIILNPLGV PARMNFGQVL ETHLGWISKQ GWKIEGDPDW AKDIRVREAQ PDSRVSSPVF       960
     DGISEGEITG LFSSVFPNRD GERAVGSDGK AILYDGRTGE PFPEPISVGY MYVLKLHHLV      1020
     DDKIHARSTG PYSMITQQPL GGKAQFGGQR FGEMEVWALE AYGAAHALQE LLTIKSDDVV      1080
     GRVKVYDAIV KGYPIPTPGV PESFKVIVKE MQSLCINIEV VSDGEDDVSA DAETLQIEEG      1140
     LDTSPKVEVG SLEEV                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page