(data stored in ACNUC30630 zone)

EMBL: BX251410.RPOC

BX251410.RPOC        Location/Qualifiers
FT   CDS             77472..81299
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="TW082"
FT                   /product="DNA-directed RNA polymerase beta' chain"
FT                   /EC_number="2.7.7.6"
FT                   /note="Similar to Aquifex pyrophilus DNA-directed RNA
FT                   polymerase beta' chain RpoC SWALL:RPOC_AQUPY (SWALL:Q9X6Y2)
FT                   (1576 aa) fasta scores: E(): 3.4e-124, 40.11% id in 1573
FT                   aa"
FT                   /db_xref="GOA:Q820D9"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q820D9"
FT                   /protein_id="CAD66767.1"
FT                   /translation="MATTEDIRRWSYGVVKKPETINYRTLKPEKDGLFGEQIFGPTRDW
FT                   ECGCGKYKRSRYRGVVCERCGVEVTQSSVRRERMGHIELAAPVTHIWYFKGVPSRLGYL
FT                   LDIAPKDLDKVIYFAAYMVVSLDEEGRKEDLQDLENELRLDIKQLRDACDASIASAVSE
FT                   LERTITELQDAKTSASRINKVRSEAENKMANIRREYDDKIEHLERVWDSFKALKVGGLY
FT                   AEDDVFRDVQDRYGDYFDACMGAEAIKRRLEDFDLQKTAQELGVQIVECRGQRKVRAIK
FT                   RLRVVNSFITSKANPACMVLDVIPVIPPELRPMVQLDAGRFAASDLNDLYRRVINRNNR
FT                   LKRLLDLGAPRIIVNNEKRMLQEAVDALFDNGRRGRPVSGTNNRTLKSLSDMLKGKSGR
FT                   FRQNLLGKRVDYSGRSVIVVGPTLQLHQCGLPKLMALELFKPFIVKRLLDLALAPNIRS
FT                   ARRMIERGDPAVWDMLDAVIKARPVLLNRAPTLHRLGIQAFEPQLVEGKAIQLHPLVCA
FT                   AFNADFDGDQMAVHLPLSLEAQAEARVLMLASNNILNPSDGRPVTLPSHDMIIGLYHLT
FT                   TVKPSAKGAGRAFSSVAEAIMAKDRGDLSISAPVKILFSNIVLDGKTLDSAVVETTLGR
FT                   AIFNEALPDGHPYINELVDKQVISSIINNLAEVYSKVEVANTLDKIKSVGFHWATRSGV
FT                   TVAISDVVSPPEKQEIISKYETQARGVQQDFEIGLLTDLERRQALVSIWSEATDRVAEA
FT                   MRKCFPDDNTINTMVTSGARGNWLQVRNIAGMRGLVANPKGETIPRPIISSYREGLSVT
FT                   EYFISTHGARKGLVDTALKTADSGYLTRRLVDVAQDVVVRERDCGFTRGVRMPVTFRGD
FT                   DGELHKVENAEHSVYGRTLAEDVKTPDDNLIAKAGEDISGIMIDSFIAAGVESVEVRSV
FT                   LTCRSKVGVCSACYGRSLATGARVDIGDAVGIVAAQSIGEPGTQLTMRTFHSGGSASAV
FT                   DITQGLPRVQELFEARTPRAAAPIAEADGTVSIEDGDRARRLILKSDNNEEFSYTVLKR
FT                   AQLRVKDGSRVSLGDQLVEGSLDPKEVLRVKGIRAVQEYLVNGVQQVYRSQGVPIHNKH
FT                   IEVIVRQMLRKVTVVDHGDTSMLPGELIDQSRYQELNREAQAEGRKTASARQEVTGITK
FT                   ASLATESWLSAASFQETTRVLTQAVISGRRDPLIGLKENVIIGNLIPAGTGLSVYRDVE
FT                   PEPRPEAISRMYPTRRPEIENLLEGDSVDPEFDFSSLTQGLELPDDYPVQ"
     MATTEDIRRW SYGVVKKPET INYRTLKPEK DGLFGEQIFG PTRDWECGCG KYKRSRYRGV        60
     VCERCGVEVT QSSVRRERMG HIELAAPVTH IWYFKGVPSR LGYLLDIAPK DLDKVIYFAA       120
     YMVVSLDEEG RKEDLQDLEN ELRLDIKQLR DACDASIASA VSELERTITE LQDAKTSASR       180
     INKVRSEAEN KMANIRREYD DKIEHLERVW DSFKALKVGG LYAEDDVFRD VQDRYGDYFD       240
     ACMGAEAIKR RLEDFDLQKT AQELGVQIVE CRGQRKVRAI KRLRVVNSFI TSKANPACMV       300
     LDVIPVIPPE LRPMVQLDAG RFAASDLNDL YRRVINRNNR LKRLLDLGAP RIIVNNEKRM       360
     LQEAVDALFD NGRRGRPVSG TNNRTLKSLS DMLKGKSGRF RQNLLGKRVD YSGRSVIVVG       420
     PTLQLHQCGL PKLMALELFK PFIVKRLLDL ALAPNIRSAR RMIERGDPAV WDMLDAVIKA       480
     RPVLLNRAPT LHRLGIQAFE PQLVEGKAIQ LHPLVCAAFN ADFDGDQMAV HLPLSLEAQA       540
     EARVLMLASN NILNPSDGRP VTLPSHDMII GLYHLTTVKP SAKGAGRAFS SVAEAIMAKD       600
     RGDLSISAPV KILFSNIVLD GKTLDSAVVE TTLGRAIFNE ALPDGHPYIN ELVDKQVISS       660
     IINNLAEVYS KVEVANTLDK IKSVGFHWAT RSGVTVAISD VVSPPEKQEI ISKYETQARG       720
     VQQDFEIGLL TDLERRQALV SIWSEATDRV AEAMRKCFPD DNTINTMVTS GARGNWLQVR       780
     NIAGMRGLVA NPKGETIPRP IISSYREGLS VTEYFISTHG ARKGLVDTAL KTADSGYLTR       840
     RLVDVAQDVV VRERDCGFTR GVRMPVTFRG DDGELHKVEN AEHSVYGRTL AEDVKTPDDN       900
     LIAKAGEDIS GIMIDSFIAA GVESVEVRSV LTCRSKVGVC SACYGRSLAT GARVDIGDAV       960
     GIVAAQSIGE PGTQLTMRTF HSGGSASAVD ITQGLPRVQE LFEARTPRAA APIAEADGTV      1020
     SIEDGDRARR LILKSDNNEE FSYTVLKRAQ LRVKDGSRVS LGDQLVEGSL DPKEVLRVKG      1080
     IRAVQEYLVN GVQQVYRSQG VPIHNKHIEV IVRQMLRKVT VVDHGDTSML PGELIDQSRY      1140
     QELNREAQAE GRKTASARQE VTGITKASLA TESWLSAASF QETTRVLTQA VISGRRDPLI      1200
     GLKENVIIGN LIPAGTGLSV YRDVEPEPRP EAISRMYPTR RPEIENLLEG DSVDPEFDFS      1260
     SLTQGLELPD DYPVQ                                                       1275
//

If you have problems or comments...

PBIL Back to PBIL home page