(data stored in ACNUC30630 zone)

EMBL: BX251410.RPSC

BX251410.RPSC        Location/Qualifiers
FT   CDS             247239..247901
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="TW213"
FT                   /product="30s ribosomal protein S3"
FT                   /note="Similar to Escherichia coli 30s ribosomal protein S3
FT                   RpsC or b3314 or z4685 or ecs4179 or stm3434 or sty4364
FT                   SWALL:RS3_ECOLI (SWALL:P02352) (232 aa) fasta scores: E():
FT                   7.2e-36, 50.72% id in 207 aa"
FT                   /db_xref="GOA:Q83I72"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I72"
FT                   /protein_id="CAD66890.1"
FT                   /translation="MGQKINPYGLRLGITTDHVSHWYSDSTRPGQRYADYVSEDIKIRS
FT                   YLTKTLDRAGIARIEIERTRDRIRVDIYTARPGIVIGRRGAEADRYRLELEKITSKQVQ
FT                   LNILEVKNPETTARLVAQGIAEQLAARVAFRRAMRKGLQSATSAGVRGIRIRLAGRLGG
FT                   AEISRSEFYIEGQVPLQTLRASIDYGFYEARTPYGHIGVKVWIYKKPSVRGRTEGGG"
     MGQKINPYGL RLGITTDHVS HWYSDSTRPG QRYADYVSED IKIRSYLTKT LDRAGIARIE        60
     IERTRDRIRV DIYTARPGIV IGRRGAEADR YRLELEKITS KQVQLNILEV KNPETTARLV       120
     AQGIAEQLAA RVAFRRAMRK GLQSATSAGV RGIRIRLAGR LGGAEISRSE FYIEGQVPLQ       180
     TLRASIDYGF YEARTPYGHI GVKVWIYKKP SVRGRTEGGG                             220
//

If you have problems or comments...

PBIL Back to PBIL home page