(data stored in ACNUC30630 zone)

EMBL: BX251410.RPSE

BX251410.RPSE        Location/Qualifiers
FT   CDS             251493..252353
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="TW223"
FT                   /product="30s ribosomal protein S5"
FT                   /note="Similar to Bacillus stearothermophilus 30s ribosomal
FT                   protein S5 RpsE SWALL:RS5_BACST (SWALL:P02357) (166 aa)
FT                   fasta scores: E(): 5.9e-26, 62.32% id in 146 aa. Has an
FT                   unusually long N-terminal extension relative to homologues
FT                   so may use a downstream alternative translational start
FT                   site."
FT                   /db_xref="GOA:Q83I62"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I62"
FT                   /protein_id="CAD66900.1"
FT                   /translation="MIHDDDTVDLTDTLADAADSTRSAPDPAPVSDASPRGSSSGADVS
FT                   DAARRQSGTVRQSGNDMVRQSGSELSDQSDTDISADSDTSASQGSARHSARGRHRDSRQ
FT                   KGDSSSRGQFLERVVRINRVAKVVKGGRKFSFSALVVVGDGDGTVGVGYGKAREVPLAI
FT                   SKGIESARKNFFTVPRVASTIPHPVQGEAASGVVLLRPAAPGTGVIAGGPVRAVLECAG
FT                   VRDVLSKSLGSSNSINVVYATLDALKHLEDPASVARRRGLDYYHVVPKRIVRAVNSVGA
FT                   SSDTA"
     MIHDDDTVDL TDTLADAADS TRSAPDPAPV SDASPRGSSS GADVSDAARR QSGTVRQSGN        60
     DMVRQSGSEL SDQSDTDISA DSDTSASQGS ARHSARGRHR DSRQKGDSSS RGQFLERVVR       120
     INRVAKVVKG GRKFSFSALV VVGDGDGTVG VGYGKAREVP LAISKGIESA RKNFFTVPRV       180
     ASTIPHPVQG EAASGVVLLR PAAPGTGVIA GGPVRAVLEC AGVRDVLSKS LGSSNSINVV       240
     YATLDALKHL EDPASVARRR GLDYYHVVPK RIVRAVNSVG ASSDTA                      286
//

If you have problems or comments...

PBIL Back to PBIL home page