(data stored in ACNUC30630 zone)

EMBL: BX251410.RPSF

BX251410.RPSF        Location/Qualifiers
FT   CDS             complement(126021..126323)
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="TW117"
FT                   /product="30s ribosomal protein S6"
FT                   /note="Similar to Streptomyces coelicolor 30s ribosomal
FT                   protein S6 RpsF or SCO3906 or SCH24.28 SWALL:RS6_STRCO
FT                   (SWALL:Q9X8U2) (96 aa) fasta scores: E(): 9.4e-07, 35.86%
FT                   id in 92 aa"
FT                   /db_xref="GOA:Q83IC0"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83IC0"
FT                   /protein_id="CAD66800.1"
FT                   /translation="MLGSPLREYELLVSLGSEFEPEAESRVRSLFTPVEPEGVTVKHLD
FT                   VLGVRKFAYEIKGRNDGVCVVVRLLANAGSIAEIGRQMRLTEDVIRTKLLRVGRK"
     MLGSPLREYE LLVSLGSEFE PEAESRVRSL FTPVEPEGVT VKHLDVLGVR KFAYEIKGRN        60
     DGVCVVVRLL ANAGSIAEIG RQMRLTEDVI RTKLLRVGRK                             100
//

If you have problems or comments...

PBIL Back to PBIL home page