(data stored in ACNUC30630 zone)

EMBL: BX251410.RPSI

BX251410.RPSI        Location/Qualifiers
FT   CDS             178713..179177
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="TW154"
FT                   /product="30s ribosomal protein S9"
FT                   /note="Similar to Escherichia coli 30s ribosomal protein S9
FT                   RpsI or b3230 or z4588 or ecs4103 SWALL:RS9_ECOLI
FT                   (SWALL:P02363) (129 aa) fasta scores: E(): 2.6e-20, 51.61%
FT                   id in 124 aa, and to Streptomyces coelicolor 30s ribosomal
FT                   protein S9 RpsI or SCO4735 or SC6G4.13 SWALL:RS9_STRCO
FT                   (SWALL:Q53875) (170 aa) fasta scores: E(): 2.4e-25, 61.6%
FT                   id in 125 aa"
FT                   /db_xref="GOA:Q83IA3"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83IA3"
FT                   /protein_id="CAD66834.1"
FT                   /translation="MVPPQRAKNDTSSAPDSAAETRGPLVSSGSGLGRRKSATARVYLS
FT                   PGEGVFVVNGRDINEYFTSKLHRQFACQPLKILDLLGSYDVKVTLHGGGASGQAGAVRL
FT                   GIARALNTIDPENNRKPLKSAGFLTRDSRVKERKKAGLKKARKAPQYSKR"
     MVPPQRAKND TSSAPDSAAE TRGPLVSSGS GLGRRKSATA RVYLSPGEGV FVVNGRDINE        60
     YFTSKLHRQF ACQPLKILDL LGSYDVKVTL HGGGASGQAG AVRLGIARAL NTIDPENNRK       120
     PLKSAGFLTR DSRVKERKKA GLKKARKAPQ YSKR                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page