(data stored in ACNUC30630 zone)

EMBL: BX251410.RPSK

BX251410.RPSK        Location/Qualifiers
FT   CDS             256600..256992
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="TW231"
FT                   /product="30S ribosomal protein S11"
FT                   /note="Similar to Escherichia coli 30s ribosomal protein
FT                   S11 RpsK or b3297 or z4667 or ecs4162 SWALL:RS11_ECOLI
FT                   (SWALL:P02366) (128 aa) fasta scores: E(): 7.1e-26, 56.69%
FT                   id in 127 aa"
FT                   /db_xref="GOA:P66366"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66366"
FT                   /protein_id="CAD66908.1"
FT                   /translation="MSKQAQSRSRKKARKNIPAGLAHIKSTFNNTIVTITDLSGNVIGW
FT                   SSSGAVGFKGSRKSTPYAAQMAADAAARSAQEHGVKKVDVFVKGPGSGRETAIRSLQTA
FT                   GLEIGSISDTTPLAFNGCRPPKKRLV"
     MSKQAQSRSR KKARKNIPAG LAHIKSTFNN TIVTITDLSG NVIGWSSSGA VGFKGSRKST        60
     PYAAQMAADA AARSAQEHGV KKVDVFVKGP GSGRETAIRS LQTAGLEIGS ISDTTPLAFN       120
     GCRPPKKRLV                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page