(data stored in ACNUC30630 zone)

EMBL: BX251410.RPSM

BX251410.RPSM        Location/Qualifiers
FT   CDS             256222..256596
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="TW230"
FT                   /product="30S ribosomal protein S13"
FT                   /note="Similar to Synechococcus sp. 30s ribosomal protein
FT                   S13 RpsM or Rps13 SWALL:RS13_SYNP6 (SWALL:O24708) (125 aa)
FT                   fasta scores: E(): 6.5e-27, 61.78% id in 123 aa"
FT                   /db_xref="GOA:P66398"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66398"
FT                   /protein_id="CAD66907.1"
FT                   /translation="MARVAGVDIPGNKRVEIGLTYICGIGPTRSRHALTAAGISFDTRV
FT                   KDLTDDQLVALRAHIQNSYRIEGDLRREVASDIRRKVEIGCYQGLRHRRGLPVNGQRTR
FT                   TNARSSKGPRRTVAGKKKAR"
     MARVAGVDIP GNKRVEIGLT YICGIGPTRS RHALTAAGIS FDTRVKDLTD DQLVALRAHI        60
     QNSYRIEGDL RREVASDIRR KVEIGCYQGL RHRRGLPVNG QRTRTNARSS KGPRRTVAGK       120
     KKAR                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page