(data stored in ACNUC30630 zone)

EMBL: BX251410.RPSN

BX251410.RPSN        Location/Qualifiers
FT   CDS             131927..132232
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="TW127"
FT                   /product="30s ribosomal protein S14"
FT                   /note="Similar to Escherichia coli 30s ribosomal protein
FT                   S14 RpsN or b3307 or z4677 or ecs4172 SWALL:RS14_ECOLI
FT                   (SWALL:P02370) (100 aa) fasta scores: E(): 5.8e-12, 47% id
FT                   in 100 aa, and to Mycobacterium tuberculosis 30s ribosomal
FT                   protein S14-2 RpsN2 or Rv2056c or mt2117 or mtcy63a.04
FT                   SWALL:R14B_MYCTU (SWALL:O86355) (101 aa) fasta scores: E():
FT                   1.2e-21, 61.38% id in 101 aa"
FT                   /db_xref="GOA:Q83IB4"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83IB4"
FT                   /protein_id="CAD66807.1"
FT                   /translation="MSKLSKIVKNEKRKVIVARYAARRQELKRIIAAPGTAPERRDEAQ
FT                   AALQKLPRDASPVRVRSRDVVDGRPRGILSRFGVSRIRFREMAHRGELPGITKSSW"
     MSKLSKIVKN EKRKVIVARY AARRQELKRI IAAPGTAPER RDEAQAALQK LPRDASPVRV        60
     RSRDVVDGRP RGILSRFGVS RIRFREMAHR GELPGITKSS W                           101
//

If you have problems or comments...

PBIL Back to PBIL home page