(data stored in ACNUC30630 zone)

EMBL: BX251410.RPSR

BX251410.RPSR        Location/Qualifiers
FT   CDS             complement(125191..125442)
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="TW115"
FT                   /product="30s ribosomal protein S18"
FT                   /note="Similar to Streptomyces coelicolor 30s ribosomal
FT                   protein S18-2 RpsR2 or SCO3425 or SCE9.32c SWALL:R18B_STRCO
FT                   (SWALL:Q9X8K4) (79 aa) fasta scores: E(): 2.5e-09, 52.77%
FT                   id in 72 aa, and to Escherichia coli, Escherichia coli
FT                   O157:H7 and Salmonella typhi 30s ribosomal protein S18 RpsR
FT                   or b4202 or z5811 or ecs5178 or sty4749 SWALL:RS18_ECOLI
FT                   (SWALL:P02374) (74 aa) fasta scores: E(): 2.1e-05, 43.39%
FT                   id in 53 aa"
FT                   /db_xref="GOA:Q83IC1"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83IC1"
FT                   /protein_id="CAD66798.1"
FT                   /translation="MGYRAKGRRQPKADSVVAPPKRVSIKGLDYKDLASLKRFLSDRGK
FT                   IRARRVTGASIQQQRQIAKAIKNAREMGVIPFKSGVSR"
     MGYRAKGRRQ PKADSVVAPP KRVSIKGLDY KDLASLKRFL SDRGKIRARR VTGASIQQQR        60
     QIAKAIKNAR EMGVIPFKSG VSR                                                83
//

If you have problems or comments...

PBIL Back to PBIL home page