(data stored in ACNUC30630 zone)

EMBL: BX251410.RPSS

BX251410.RPSS        Location/Qualifiers
FT   CDS             246596..246877
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="TW211"
FT                   /product="30s ribosomal protein s19"
FT                   /note="Similar to Escherichia coli 30s ribosomal protein
FT                   S19 RpsS or b3316 or z4687 or ecs4181 SWALL:RS19_ECOLI
FT                   (SWALL:P02375) (91 aa) fasta scores: E(): 6.9e-26, 67.39%
FT                   id in 92 aa"
FT                   /db_xref="GOA:Q83I74"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I74"
FT                   /protein_id="CAD66888.1"
FT                   /translation="MPRSLKKGPFVDMHLLKKVRAGNESKDRNMIKTWSRRSMIIPEML
FT                   GHTIAVHDGRRHIPVFITESMVGHKLGEFAPTRTYRGHVKDDRKARRR"
     MPRSLKKGPF VDMHLLKKVR AGNESKDRNM IKTWSRRSMI IPEMLGHTIA VHDGRRHIPV        60
     FITESMVGHK LGEFAPTRTY RGHVKDDRKA RRR                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page