(data stored in ACNUC30630 zone)

EMBL: BX251410.SECY

BX251410.SECY        Location/Qualifiers
FT   CDS             253023..254348
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="TW225"
FT                   /product="preprotein translocase SecY subunit"
FT                   /note="Similar to Streptomyces griseus preprotein
FT                   translocase SecY subunit SWALL:SECY_STRGR (SWALL:Q59916)
FT                   (437 aa) fasta scores: E(): 2.9e-97, 57.52% id in 445 aa"
FT                   /protein_id="CAD66902.1"
FT                   /translation="MFGVVRRMFSTTDLRRKLLFSVFIIVIFRLGSFIPSPYVNFTNVQ
FT                   VCLAANSGATGIYELINLFSGGALLQLSVFALGVMPYITSSIIIQLLRVVVPRFEQLYK
FT                   QGQEGQAKLIQYTRYLTIGLAVLQSTTLITVARSGALFAASNSPACSSLLTDDSWYSTI
FT                   IIVIVMTAGTGLIMWLGELITERGIGNGMSILIFTSIAAGFPGVLVGVYQTRGFGMFST
FT                   VVITSLVVMVGVVFVEQSQRRVPVQYAKRVVGRRILGGGSTYLPIKLNMAGVVPVIFAS
FT                   AILRVPSIIAQFSQPAPGQPPAAWVVWINENFTTGNSPFYIALYFFMIVGFTYFYVAVT
FT                   FNPTEIADNMKNYGGFISGIRPGVPTANYLSYIIKRITLPGSLYLGIVSLIPLIAFALF
FT                   GLSADIPLGGTSVLIMVGVGLDTVKQIDAQMQQRHYRGLLTA"
     MFGVVRRMFS TTDLRRKLLF SVFIIVIFRL GSFIPSPYVN FTNVQVCLAA NSGATGIYEL        60
     INLFSGGALL QLSVFALGVM PYITSSIIIQ LLRVVVPRFE QLYKQGQEGQ AKLIQYTRYL       120
     TIGLAVLQST TLITVARSGA LFAASNSPAC SSLLTDDSWY STIIIVIVMT AGTGLIMWLG       180
     ELITERGIGN GMSILIFTSI AAGFPGVLVG VYQTRGFGMF STVVITSLVV MVGVVFVEQS       240
     QRRVPVQYAK RVVGRRILGG GSTYLPIKLN MAGVVPVIFA SAILRVPSII AQFSQPAPGQ       300
     PPAAWVVWIN ENFTTGNSPF YIALYFFMIV GFTYFYVAVT FNPTEIADNM KNYGGFISGI       360
     RPGVPTANYL SYIIKRITLP GSLYLGIVSL IPLIAFALFG LSADIPLGGT SVLIMVGVGL       420
     DTVKQIDAQM QQRHYRGLLT A                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page