(data stored in ACNUC30630 zone)

EMBL: BX251410.SSB1

BX251410.SSB1        Location/Qualifiers
FT   CDS             complement(125457..126017)
FT                   /transl_table=11
FT                   /gene="ssb1"
FT                   /locus_tag="TW116"
FT                   /product="single-strand binding protein"
FT                   /note="Similar to Escherichia coli and Escherichia coli
FT                   O157:H7 single-strand binding protein Ssb or ExrB or LexC
FT                   or b4059 or z5658 or ecs5041 SWALL:SSB_ECOLI (SWALL:P02339)
FT                   (177 aa) fasta scores: E(): 8.8e-08, 27.95% id in 186 aa,
FT                   and to Mycobacterium smegmatis single-stranded DNA-binding
FT                   protein SWALL:Q9AFI5 (EMBL:AF349434) (165 aa) fasta scores:
FT                   E(): 6.6e-32, 68.29% id in 123 aa"
FT                   /db_xref="GOA:Q83NU2"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83NU2"
FT                   /protein_id="CAD66799.1"
FT                   /translation="MDATVTVVGNLTADPELRYTATGAAVVNMTIASTPRMYDRQSGEW
FT                   KDGEPLFLRGILWREYAINAAASLAKGMRVVAVGKLKQRNYETREGDRRTSVELEIDEI
FT                   GPTLRYATAKCSRATQAGHGVSPDPWADSQTGQGIDSHTTRSEEITENAKNGEGAGKNE
FT                   LNKKVLVGDNVSYEDFDSDEVPF"
     MDATVTVVGN LTADPELRYT ATGAAVVNMT IASTPRMYDR QSGEWKDGEP LFLRGILWRE        60
     YAINAAASLA KGMRVVAVGK LKQRNYETRE GDRRTSVELE IDEIGPTLRY ATAKCSRATQ       120
     AGHGVSPDPW ADSQTGQGID SHTTRSEEIT ENAKNGEGAG KNELNKKVLV GDNVSYEDFD       180
     SDEVPF                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page