(data stored in ACNUC30630 zone)

EMBL: BX251410.TIG

BX251410.TIG         Location/Qualifiers
FT   CDS             316355..317668
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="TW281"
FT                   /product="trigger factor"
FT                   /note="Similar to Escherichia coli trigger factor Tig or
FT                   b0436 or z0541 or ecs0490 SWALL:TIG_ECOLI (SWALL:P22257)
FT                   (432 aa) fasta scores: E(): 2.8e-12, 25.55% id in 407 aa,
FT                   and to Streptomyces coelicolor trigger factor Tig or
FT                   SCO2620 or SCC80.05c SWALL:Q9F314 (EMBL:AL442143) (468 aa)
FT                   fasta scores: E(): 6.4e-24, 30.9% id in 453 aa"
FT                   /protein_id="CAD66955.1"
FT                   /translation="MGRTLKSIVQRVSETELKLQVTIPSESLKPHVDRAYREVAKTVSV
FT                   PGFRRGKVPVRIIDQRIGKHVVLDRAINDCIGDFFQSAVDEQGLTPVAAPKAHIASLPT
FT                   EPDASLEVVFDVHVYPDVDFPAFENKQIEVDAIDVTDSMVDSEIVGIREKLATFTALDR
FT                   PAIDGDFLILDLQILDGDKVLSESNAVPYELGSNTLFDGLDSALTSARAGYTTTIDLTP
FT                   PVEDPAGENPQQDQFAKSGDTRRVKLKVSSVNKRDLPEENDELARLVGGFANLEELRKD
FT                   SAKNIERSMLFQRSLQARDLLLEQLLSEITFPLPGPIADVLDEIKDEEEKQNRTKQARR
FT                   DILLDLLAKTFSVTLKEDELERYLSSAAAQRKMSVATLVSVIKSAGQDKYVISDIVRNK
FT                   ALSIALSRVKVIDSAGNPLDISEFTIKTDGDPKVRRSE"
     MGRTLKSIVQ RVSETELKLQ VTIPSESLKP HVDRAYREVA KTVSVPGFRR GKVPVRIIDQ        60
     RIGKHVVLDR AINDCIGDFF QSAVDEQGLT PVAAPKAHIA SLPTEPDASL EVVFDVHVYP       120
     DVDFPAFENK QIEVDAIDVT DSMVDSEIVG IREKLATFTA LDRPAIDGDF LILDLQILDG       180
     DKVLSESNAV PYELGSNTLF DGLDSALTSA RAGYTTTIDL TPPVEDPAGE NPQQDQFAKS       240
     GDTRRVKLKV SSVNKRDLPE ENDELARLVG GFANLEELRK DSAKNIERSM LFQRSLQARD       300
     LLLEQLLSEI TFPLPGPIAD VLDEIKDEEE KQNRTKQARR DILLDLLAKT FSVTLKEDEL       360
     ERYLSSAAAQ RKMSVATLVS VIKSAGQDKY VISDIVRNKA LSIALSRVKV IDSAGNPLDI       420
     SEFTIKTDGD PKVRRSE                                                      437
//

If you have problems or comments...

PBIL Back to PBIL home page