(data stored in ACNUC30630 zone)

EMBL: BX251410.TRUB

BX251410.TRUB        Location/Qualifiers
FT   CDS             complement(96582..97733)
FT                   /transl_table=11
FT                   /gene="truB"
FT                   /locus_tag="TW097"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /EC_number="4.2.1.70"
FT                   /note="Similar to Escherichia coli and Escherichia coli
FT                   O157:H7 tRNA pseudouridine synthase B TruB or p35 or b3166
FT                   or z4527 or ecs4047 SWALL:TRUB_ECOLI (SWALL:P09171) (314
FT                   aa) fasta scores: E(): 2.2e-23, 35.24% id in 227 aa"
FT                   /db_xref="GOA:Q820Z5"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q820Z5"
FT                   /protein_id="CAD66781.1"
FT                   /translation="MLGKVERSEMYILFAMTQVLLVDKISGITSHTAVAKIRHLTGVKK
FT                   IGHCGTLDPAACGLLIMGCGTATRLIRYMSNLDKRYIATITLGTQTTTDDSEGEIIYSA
FT                   PKPSLDKITLESIGRAAEKLSGTIKQIPSAYSAIKVSGNRAYNLARQGIIPKLNAREVR
FT                   VHWKFLGDFENNQVHVQITCSSGTYVRALARDMGKFLGVGGHLSYLKRLSIGPFHLHEI
FT                   YREINKKEATMSERTPSGNTQGLTDNMAISDNMAISESDKHDCTEPGINCTELGIKDTC
FT                   TALREVHYTQGDTLSFTRLTALQALSRIYKPIEVSQKQADDLSCGRYISLGIDSNGPVC
FT                   AVCKENLIAVIQPVSAGLWRPETVLSDNRKLNSNAAQDASGST"
     MLGKVERSEM YILFAMTQVL LVDKISGITS HTAVAKIRHL TGVKKIGHCG TLDPAACGLL        60
     IMGCGTATRL IRYMSNLDKR YIATITLGTQ TTTDDSEGEI IYSAPKPSLD KITLESIGRA       120
     AEKLSGTIKQ IPSAYSAIKV SGNRAYNLAR QGIIPKLNAR EVRVHWKFLG DFENNQVHVQ       180
     ITCSSGTYVR ALARDMGKFL GVGGHLSYLK RLSIGPFHLH EIYREINKKE ATMSERTPSG       240
     NTQGLTDNMA ISDNMAISES DKHDCTEPGI NCTELGIKDT CTALREVHYT QGDTLSFTRL       300
     TALQALSRIY KPIEVSQKQA DDLSCGRYIS LGIDSNGPVC AVCKENLIAV IQPVSAGLWR       360
     PETVLSDNRK LNSNAAQDAS GST                                               383
//

If you have problems or comments...

PBIL Back to PBIL home page