(data stored in ACNUC30630 zone)

EMBL: BX251410.TUFA

BX251410.TUFA        Location/Qualifiers
FT   CDS             136972..138165
FT                   /transl_table=11
FT                   /gene="tufA"
FT                   /locus_tag="TW131"
FT                   /product="elongation factor TU-1"
FT                   /note="Similar to Escherichia coli elongation factor TU
FT                   (TufA or b3339) and (TufB or b3980) SWALL:EFTU_ECOLI
FT                   (SWALL:P02990) (393 aa) fasta scores: E(): 1.1e-103, 70.38%
FT                   id in 395 aa, and to Micrococcus luteus elongation factor
FT                   TU Tuf or TufA SWALL:EFTU_MICLU (SWALL:P09953) (396 aa)
FT                   fasta scores: E(): 6.3e-119, 82.02% id in 395 aa"
FT                   /db_xref="GOA:Q83NT9"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83NT9"
FT                   /protein_id="CAD66811.1"
FT                   /translation="MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAISRVLSERLPSNTN
FT                   VKQDFDAIDSAPEERQRGITINISHIEYETEKRHYAHVDAPGHADYIKNMITGAAQMDG
FT                   AILVVAATDGAMAQTREHVLLAKQVGVPYLLVALNKADMVSDEEILELVELEVRELLST
FT                   HGFDGENVPVVRVSGLKALEGDQKWGDAVMELMKAVDESIPDPVRDRDKPFLMPIEDVF
FT                   TITGRGTVVTGRAERGVLAVNSEVEIVGIRPTQKTTVTGIEMFRKQLDEAWAGENCGLL
FT                   LRGTKREDVERGQVVVKPGSVTPHTKFEGKAYILSKDEGGRHNPFYSNYRPQFYFRTTD
FT                   VTGVITLPEGTEMVMPGDTISITVDLIQPIAMEEGLGFAIREGGRTVGAGTVVKILE"
     MAKAKFERTK PHVNIGTIGH VDHGKTTLTA AISRVLSERL PSNTNVKQDF DAIDSAPEER        60
     QRGITINISH IEYETEKRHY AHVDAPGHAD YIKNMITGAA QMDGAILVVA ATDGAMAQTR       120
     EHVLLAKQVG VPYLLVALNK ADMVSDEEIL ELVELEVREL LSTHGFDGEN VPVVRVSGLK       180
     ALEGDQKWGD AVMELMKAVD ESIPDPVRDR DKPFLMPIED VFTITGRGTV VTGRAERGVL       240
     AVNSEVEIVG IRPTQKTTVT GIEMFRKQLD EAWAGENCGL LLRGTKREDV ERGQVVVKPG       300
     SVTPHTKFEG KAYILSKDEG GRHNPFYSNY RPQFYFRTTD VTGVITLPEG TEMVMPGDTI       360
     SITVDLIQPI AMEEGLGFAI REGGRTVGAG TVVKILE                                397
//

If you have problems or comments...

PBIL Back to PBIL home page