(data stored in ACNUC1104 zone)

EMBL: BX640427.ACRA

BX640427.ACRA        Location/Qualifiers
FT   CDS             158908..160098
FT                   /transl_table=11
FT                   /gene="acrA"
FT                   /gene_synonym="mtcA"
FT                   /gene_synonym="lir"
FT                   /locus_tag="BPP1453"
FT                   /product="acriflavine resistance protein a precursor"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0984"
FT                   /db_xref="GOA:Q7WAC6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAC6"
FT                   /protein_id="CAE36755.1"
FT                   /translation="MKNNYLVGRGIAALSLAALTLTLAACGKEQQAAQQGGQPQVGVVT
FT                   LKTQSVALFSELPGRTAAYRIAEVCPQVSGIVQKRLFTEGGEVAAGQQLYQIDPALYQA
FT                   EVDSRRAALARVQAQLKTATLLVQRYKPLVDTRAVSRQAYDDAVAARDQASADVLAAKA
FT                   ALDTARINLVYTKVLAPIGGIIGRSNVTEGALVTANQSAAVAAVQQIDPIYVDVTQSSV
FT                   QLLRLKSALDSGLLQREAGEQSARVTLTLEDGTQYDQDGKLQFSEVTVDPGTGSVLLRA
FT                   VFPNPQRKLLPGMFVRARLAEGVASEGLLVPQRGVTRNQRGLPTALVVNVENKVELRTL
FT                   KTDRAIGDQWLVSSGLAAGDRVIVEGLQSVRPGAEVKAAEWSPPASKAAAQPAAAK"
     MKNNYLVGRG IAALSLAALT LTLAACGKEQ QAAQQGGQPQ VGVVTLKTQS VALFSELPGR        60
     TAAYRIAEVC PQVSGIVQKR LFTEGGEVAA GQQLYQIDPA LYQAEVDSRR AALARVQAQL       120
     KTATLLVQRY KPLVDTRAVS RQAYDDAVAA RDQASADVLA AKAALDTARI NLVYTKVLAP       180
     IGGIIGRSNV TEGALVTANQ SAAVAAVQQI DPIYVDVTQS SVQLLRLKSA LDSGLLQREA       240
     GEQSARVTLT LEDGTQYDQD GKLQFSEVTV DPGTGSVLLR AVFPNPQRKL LPGMFVRARL       300
     AEGVASEGLL VPQRGVTRNQ RGLPTALVVN VENKVELRTL KTDRAIGDQW LVSSGLAAGD       360
     RVIVEGLQSV RPGAEVKAAE WSPPASKAAA QPAAAK                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page