(data stored in ACNUC1104 zone)

EMBL: BX640427.ACRB

BX640427.ACRB        Location/Qualifiers
FT   CDS             160111..163290
FT                   /transl_table=11
FT                   /gene="acrB"
FT                   /gene_synonym="acrE"
FT                   /locus_tag="BPP1454"
FT                   /product="acriflavine resistance protein B"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0985"
FT                   /db_xref="GOA:Q7WAC5"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAC5"
FT                   /protein_id="CAE36756.1"
FT                   /translation="MTKFFIDRPVFAWVIAIVLMMAGALSILSLPVAQYPNIAPPAISI
FT                   NVTYPGASAQTVQDTVVQVIEQQMNGIDNLQYISSESNSDGSMSITLTFSQGTNPDTAQ
FT                   VQVQNKLAVAQPLLPLEVQQQGIRVTKATKNFLIVAGFVSTDGTMDKSDLADYVASYIQ
FT                   DPISRTPGVGDFQLFGAPYAMRIWISPEKLVNFGLTASDVTTAIREQNVQVSSGQLGGQ
FT                   PAVRGQQLNATVIGPSRLQTPEAFGRILLKVNSDGSQVRLKDVASIELGAQTYAIDSYY
FT                   NGKPASGLAIKLASGANALDTAQAVRETINGLKPYFPPGMDVVYPYDTTPFVSLSIEGV
FT                   VKTLFEAVLLVFLVMYLFLQNVRATLIPTLAVPVVLLGTFGVLAAFGYSINTLTMFGMV
FT                   LAIGLLVDDAIVVVENVERVMAEEGLSPRQATRKSMSQITGALIGIAMVLAVVFVPMAF
FT                   FGGSTGVIYRQFSITIVSSMVLSVVVAIVFTPALCATMLKPIPKGHHGSKKGFFGRFNR
FT                   TFERSSQAYANNVARSMGRTKRLLLIYVVILLGMAWMFMRIPTAFLPDEDQGILFAQVQ
FT                   APAGATSERTQATIDAAVKYLLEDEKESVASVFAVNGFSFGGRGQNAAILFIKLRDWNE
FT                   RKGAEHRAAAVAARANAKFRAELRDAQAAVFVPPAVMELGNATGFDFQLQDRAGVGHEK
FT                   LLAARNQLLQEAGASPMLVAVRPNGIEDAPQYQLDIDREKARALGVSITEINNTLATAW
FT                   GSSYVNDFIDRGRVKKVFVQGEASSRMLPQDLDKWYVRNNAGDMVPFSAFSSAQWTFGP
FT                   QKLNRYNGVPSYNIQGQAAPGYSSGDAMAEMERLADKLPLGIGYDWTGLSFEERLSGAQ
FT                   APALYAISLIVVFLCLAALYESWSIPTAVMLVVPLGVVGALLATLTRGLSNDVYFQVGL
FT                   LTTIGLAAKNAILIVEFAKEHYEEGASLTEAAVHAARQRLRPILMTSLAFILGVVPLAI
FT                   STGAGSGSQNAIGTGVIGGMLTGTFLAIFFVPLFFVLTLRLFKVKRASENREDDDPHGG
FT                   AQPATHGGQPQ"
     MTKFFIDRPV FAWVIAIVLM MAGALSILSL PVAQYPNIAP PAISINVTYP GASAQTVQDT        60
     VVQVIEQQMN GIDNLQYISS ESNSDGSMSI TLTFSQGTNP DTAQVQVQNK LAVAQPLLPL       120
     EVQQQGIRVT KATKNFLIVA GFVSTDGTMD KSDLADYVAS YIQDPISRTP GVGDFQLFGA       180
     PYAMRIWISP EKLVNFGLTA SDVTTAIREQ NVQVSSGQLG GQPAVRGQQL NATVIGPSRL       240
     QTPEAFGRIL LKVNSDGSQV RLKDVASIEL GAQTYAIDSY YNGKPASGLA IKLASGANAL       300
     DTAQAVRETI NGLKPYFPPG MDVVYPYDTT PFVSLSIEGV VKTLFEAVLL VFLVMYLFLQ       360
     NVRATLIPTL AVPVVLLGTF GVLAAFGYSI NTLTMFGMVL AIGLLVDDAI VVVENVERVM       420
     AEEGLSPRQA TRKSMSQITG ALIGIAMVLA VVFVPMAFFG GSTGVIYRQF SITIVSSMVL       480
     SVVVAIVFTP ALCATMLKPI PKGHHGSKKG FFGRFNRTFE RSSQAYANNV ARSMGRTKRL       540
     LLIYVVILLG MAWMFMRIPT AFLPDEDQGI LFAQVQAPAG ATSERTQATI DAAVKYLLED       600
     EKESVASVFA VNGFSFGGRG QNAAILFIKL RDWNERKGAE HRAAAVAARA NAKFRAELRD       660
     AQAAVFVPPA VMELGNATGF DFQLQDRAGV GHEKLLAARN QLLQEAGASP MLVAVRPNGI       720
     EDAPQYQLDI DREKARALGV SITEINNTLA TAWGSSYVND FIDRGRVKKV FVQGEASSRM       780
     LPQDLDKWYV RNNAGDMVPF SAFSSAQWTF GPQKLNRYNG VPSYNIQGQA APGYSSGDAM       840
     AEMERLADKL PLGIGYDWTG LSFEERLSGA QAPALYAISL IVVFLCLAAL YESWSIPTAV       900
     MLVVPLGVVG ALLATLTRGL SNDVYFQVGL LTTIGLAAKN AILIVEFAKE HYEEGASLTE       960
     AAVHAARQRL RPILMTSLAF ILGVVPLAIS TGAGSGSQNA IGTGVIGGML TGTFLAIFFV      1020
     PLFFVLTLRL FKVKRASENR EDDDPHGGAQ PATHGGQPQ                             1059
//

If you have problems or comments...

PBIL Back to PBIL home page