(data stored in ACNUC1104 zone)

EMBL: BX640427.CHEA

BX640427.CHEA        Location/Qualifiers
FT   CDS             184100..186157
FT                   /transl_table=11
FT                   /gene="cheA"
FT                   /locus_tag="BPP1472"
FT                   /product="chemotaxis protein CheA"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1028"
FT                   /db_xref="GOA:Q7WAA8"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR015162"
FT                   /db_xref="InterPro:IPR035891"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAA8"
FT                   /protein_id="CAE36774.1"
FT                   /translation="MSSGLDLSQFYETFFDEADELLAQMEQLLLELDVGAPDIEQLNAI
FT                   FRAAHSIKGGAATFGCFQKLAGTTHLLENLLDAIRRGEMGLRADMVDIFLETKDVLKSQ
FT                   LDAYRASEEPEDAVFERICAVLRQLALEGGQAPAAAAPAPVAASEPGPEPEPAPQPAAA
FT                   STAAGLPLRVRFSKVSDKDAQSLLEEMGNLGDVRASERAGQTLTVWVDTTCSPDDIEAV
FT                   CCFIIDADQLEIAREAEPAHASAQAAVAAAPDAAATPAPVAAPAAAQAAEPARAARPSI
FT                   APAHADKESTSIRVGVEKVDQVINLVGELVITQAMLAQTASTLDPVLHDRLLNGMEQLE
FT                   RNARDLQEAVMSIRMMPMDYVFSRFPRLVRDIAGKMGKQIELQTYGRATELDKSLIERI
FT                   IDPLTHLVRNSLDHGIETPDKRVAAGKEPVGQLVLSAQHNGGNIVIEVSDDGGGLSRER
FT                   ILRKAVAQGLTVNENSPDDEIWQLIFAPGFSTGDQVTDISGRGVGMDVVRRNIQDMGGH
FT                   VQLSSVPGQGTTTRIVLPLTLAILDGMSVRVGEETFILPLNHVTESLQPQADQIYSVAG
FT                   NERVMQVRGEYLPLVEMHRVFSVGQAQADPTQAIAVIMQAEERRFALLVDHLVGQHQVV
FT                   VKNLESNYRKVPGISAATILGDGSVALIVDVFALARANREKWSQPEAILN"
     MSSGLDLSQF YETFFDEADE LLAQMEQLLL ELDVGAPDIE QLNAIFRAAH SIKGGAATFG        60
     CFQKLAGTTH LLENLLDAIR RGEMGLRADM VDIFLETKDV LKSQLDAYRA SEEPEDAVFE       120
     RICAVLRQLA LEGGQAPAAA APAPVAASEP GPEPEPAPQP AAASTAAGLP LRVRFSKVSD       180
     KDAQSLLEEM GNLGDVRASE RAGQTLTVWV DTTCSPDDIE AVCCFIIDAD QLEIAREAEP       240
     AHASAQAAVA AAPDAAATPA PVAAPAAAQA AEPARAARPS IAPAHADKES TSIRVGVEKV       300
     DQVINLVGEL VITQAMLAQT ASTLDPVLHD RLLNGMEQLE RNARDLQEAV MSIRMMPMDY       360
     VFSRFPRLVR DIAGKMGKQI ELQTYGRATE LDKSLIERII DPLTHLVRNS LDHGIETPDK       420
     RVAAGKEPVG QLVLSAQHNG GNIVIEVSDD GGGLSRERIL RKAVAQGLTV NENSPDDEIW       480
     QLIFAPGFST GDQVTDISGR GVGMDVVRRN IQDMGGHVQL SSVPGQGTTT RIVLPLTLAI       540
     LDGMSVRVGE ETFILPLNHV TESLQPQADQ IYSVAGNERV MQVRGEYLPL VEMHRVFSVG       600
     QAQADPTQAI AVIMQAEERR FALLVDHLVG QHQVVVKNLE SNYRKVPGIS AATILGDGSV       660
     ALIVDVFALA RANREKWSQP EAILN                                             685
//

If you have problems or comments...

PBIL Back to PBIL home page