(data stored in ACNUC1104 zone)

EMBL: BX640427.CHEB

BX640427.CHEB        Location/Qualifiers
FT   CDS             189318..190370
FT                   /transl_table=11
FT                   /gene="cheB"
FT                   /locus_tag="BPP1476"
FT                   /product="protein-glutamate methylesterase"
FT                   /EC_number="3.1.1.61"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1032"
FT                   /db_xref="GOA:Q7WAA4"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WAA4"
FT                   /protein_id="CAE36778.1"
FT                   /translation="MKKIKVLCVDDSALVRGLMTEIINSHPDMEVVATAPDPLVARELI
FT                   KKHNPDVLTLDVEMPRMDGLDFLEKLMRLRPMPVVMVSSLTERGGEITLRALELGAIDF
FT                   VTKPKLGIRDGLIEYSEVIADKIRAASRARLRAPAPAGHAAPLRLRSPFASSEKLVIVG
FT                   ASTGGTEAIREVLQPLPADSPAILITQHMPAGFTRSFAQRLDALCAVTVREASDGERVL
FT                   PGHVYLAPGGETHMRLGRSGANYVIGLQASEPVNRHRPSVDVLFHSAAEAAGGNAIGVI
FT                   LTGMGKDGAAGLLAMKRAGARTMAQDEASCVVFGMPREAIALGAADEVMPLADISERIL
FT                   TRLGDRGHRV"
     MKKIKVLCVD DSALVRGLMT EIINSHPDME VVATAPDPLV ARELIKKHNP DVLTLDVEMP        60
     RMDGLDFLEK LMRLRPMPVV MVSSLTERGG EITLRALELG AIDFVTKPKL GIRDGLIEYS       120
     EVIADKIRAA SRARLRAPAP AGHAAPLRLR SPFASSEKLV IVGASTGGTE AIREVLQPLP       180
     ADSPAILITQ HMPAGFTRSF AQRLDALCAV TVREASDGER VLPGHVYLAP GGETHMRLGR       240
     SGANYVIGLQ ASEPVNRHRP SVDVLFHSAA EAAGGNAIGV ILTGMGKDGA AGLLAMKRAG       300
     ARTMAQDEAS CVVFGMPREA IALGAADEVM PLADISERIL TRLGDRGHRV                  350
//

If you have problems or comments...

PBIL Back to PBIL home page