(data stored in ACNUC1104 zone)

EMBL: BX640427.CHEW

BX640427.CHEW        Location/Qualifiers
FT   CDS             186154..186672
FT                   /transl_table=11
FT                   /gene="cheW"
FT                   /locus_tag="BPP1473"
FT                   /product="chemotaxis protein CheW"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1029"
FT                   /db_xref="GOA:Q7WAA7"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAA7"
FT                   /protein_id="CAE36775.1"
FT                   /translation="MTERHIMAAKPHTQATRAEDVGNEFLVFTLGEEEYGIDILKVQEI
FT                   RGYDAATVTRIANVPSFIKGVTNLRGIIVPIVDLRIKFNLGSVEYNEQTVVIILNLDRR
FT                   VVGIVVDGVSDVLMLNAAQVRPAPEFGATLSTEYLTGLGTVDERMLILVDIEKLMTSDE
FT                   MALVEKVAS"
     MTERHIMAAK PHTQATRAED VGNEFLVFTL GEEEYGIDIL KVQEIRGYDA ATVTRIANVP        60
     SFIKGVTNLR GIIVPIVDLR IKFNLGSVEY NEQTVVIILN LDRRVVGIVV DGVSDVLMLN       120
     AAQVRPAPEF GATLSTEYLT GLGTVDERML ILVDIEKLMT SDEMALVEKV AS               172
//

If you have problems or comments...

PBIL Back to PBIL home page