(data stored in ACNUC1104 zone)

EMBL: BX640427.CHEY

BX640427.CHEY        Location/Qualifiers
FT   CDS             183693..184073
FT                   /transl_table=11
FT                   /gene="cheY"
FT                   /locus_tag="BPP1471"
FT                   /product="chemotaxis protein CheY"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1026"
FT                   /db_xref="GOA:Q7WAA9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAA9"
FT                   /protein_id="CAE36773.1"
FT                   /translation="MTARILVADDSATMRMIVQAALTGAGWQVVTASDGKQALELAQAQ
FT                   AVDLVVSDWNMPVMGGLDLIRGLRGQARYQDLPVLVLTTEDDGDSKAAARDLGVCGWLN
FT                   KPLDPDVLVDLAAELLGVAPGA"
     MTARILVADD SATMRMIVQA ALTGAGWQVV TASDGKQALE LAQAQAVDLV VSDWNMPVMG        60
     GLDLIRGLRG QARYQDLPVL VLTTEDDGDS KAAARDLGVC GWLNKPLDPD VLVDLAAELL       120
     GVAPGA                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page