(data stored in ACNUC1104 zone)

EMBL: BX640427.CHEZ

BX640427.CHEZ        Location/Qualifiers
FT   CDS             190821..191453
FT                   /transl_table=11
FT                   /gene="cheZ"
FT                   /locus_tag="BPP1478"
FT                   /product="chemotaxis protein CheZ"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1034"
FT                   /db_xref="GOA:Q7WAA2"
FT                   /db_xref="InterPro:IPR007439"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAA2"
FT                   /protein_id="CAE36780.1"
FT                   /translation="MNATDTGMQADPTDLIQRIASLTRMLRDSMRELGLDQAIKDAAEA
FT                   IPDARDRLRYLAQMTEQAANRVLNAIEAAGPIQDGMARGAQALDERWQQWYDQPLELPQ
FT                   ARALVQDTRAFLAAVPQHTQQTQAKLMEIVMAQDFQDLTGQVIMRMMDVVGAIERELLQ
FT                   VLLDNVPQERRDEANSLLNGPQVNPGGKADVVTSQDQVDDLLASLGF"
     MNATDTGMQA DPTDLIQRIA SLTRMLRDSM RELGLDQAIK DAAEAIPDAR DRLRYLAQMT        60
     EQAANRVLNA IEAAGPIQDG MARGAQALDE RWQQWYDQPL ELPQARALVQ DTRAFLAAVP       120
     QHTQQTQAKL MEIVMAQDFQ DLTGQVIMRM MDVVGAIERE LLQVLLDNVP QERRDEANSL       180
     LNGPQVNPGG KADVVTSQDQ VDDLLASLGF                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page