(data stored in ACNUC1104 zone)

EMBL: BX640427.CVPA

BX640427.CVPA        Location/Qualifiers
FT   CDS             232791..233279
FT                   /transl_table=11
FT                   /gene="cvpA"
FT                   /gene_synonym="dedE"
FT                   /locus_tag="BPP1521"
FT                   /product="colicin V production protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1414"
FT                   /db_xref="GOA:Q7WA66"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA66"
FT                   /protein_id="CAE36823.1"
FT                   /translation="MTGFDFVVLTILAVSAVLGLVRGLLKEILSLLAYLLAFVAAIWWG
FT                   PTVYVWLEPYIETALLRMGIAYAVVFIIVLLAVGLVNMTLAALIRTTGLTPADHGLGAM
FT                   FGLARGLVLVLVLVALAGFTPLPQEDWWRDAMFSHSATEAVRQVKSWLPPSLATWLPY"
     MTGFDFVVLT ILAVSAVLGL VRGLLKEILS LLAYLLAFVA AIWWGPTVYV WLEPYIETAL        60
     LRMGIAYAVV FIIVLLAVGL VNMTLAALIR TTGLTPADHG LGAMFGLARG LVLVLVLVAL       120
     AGFTPLPQED WWRDAMFSHS ATEAVRQVKS WLPPSLATWL PY                          162
//

If you have problems or comments...

PBIL Back to PBIL home page