(data stored in ACNUC1104 zone)

EMBL: BX640427.FABZ

BX640427.FABZ        Location/Qualifiers
FT   CDS             252114..252617
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /gene_synonym="sefA"
FT                   /locus_tag="BPP1538"
FT                   /product="(3R)-hydroxymyristol-[acyl carrier protein]
FT                   dehydratase"
FT                   /EC_number="4.2.1.-"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1430"
FT                   /db_xref="GOA:Q7WA49"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WA49"
FT                   /protein_id="CAE36840.1"
FT                   /translation="MAAHCNIIYFCFAGKQMELDIKGIMDRLPHRYPMLLIDRVLEMVP
FT                   GKSIVAIKNVSINEPFFTGHFPHHPVMPGVLIVEAMAQASALFSFTDENGGLKCDGAKT
FT                   AYYLVGIDGARFRKPVVPGDQLRLEVEAERLSCTICKYQGRALVDGQLVAEAKLMCAIR
FT                   SLEE"
     MAAHCNIIYF CFAGKQMELD IKGIMDRLPH RYPMLLIDRV LEMVPGKSIV AIKNVSINEP        60
     FFTGHFPHHP VMPGVLIVEA MAQASALFSF TDENGGLKCD GAKTAYYLVG IDGARFRKPV       120
     VPGDQLRLEV EAERLSCTIC KYQGRALVDG QLVAEAKLMC AIRSLEE                     167
//

If you have problems or comments...

PBIL Back to PBIL home page