(data stored in ACNUC1104 zone)

EMBL: BX640427.FLGA

BX640427.FLGA        Location/Qualifiers
FT   CDS             complement(198244..199119)
FT                   /transl_table=11
FT                   /gene="flgA"
FT                   /locus_tag="BPP1484"
FT                   /product="flagella basal body P-ring formation protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1372"
FT                   /db_xref="GOA:Q7WA98"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017585"
FT                   /db_xref="InterPro:IPR039246"
FT                   /db_xref="InterPro:IPR041231"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA98"
FT                   /protein_id="CAE36786.1"
FT                   /translation="MRTDWPKKTGRTAWLAFWHDGILGCGRPPQKAKQPAISEPIRLLR
FT                   GTAPFYNLPIMKSPRSRSIARLAALAILAGAMPRAAAEPPAQDPAELAAAAESYLRQQL
FT                   AALPGEPSITLDPLRTDRLDACEALTPFMPSGMRVRARMTVGLRCVAPRTWTVYAQATV
FT                   SVPGQYYVAARQIAPGKTIEAADLTTRDGDLVALPPGVITDAAAILGMRPAHRIAAGQP
FT                   IKGAGLRSAESVSRGQSVRITARGNGFVVSSEGQALDNAPPSATVQVRTASGQVVSGIV
FT                   QAAGLVEIQL"
     MRTDWPKKTG RTAWLAFWHD GILGCGRPPQ KAKQPAISEP IRLLRGTAPF YNLPIMKSPR        60
     SRSIARLAAL AILAGAMPRA AAEPPAQDPA ELAAAAESYL RQQLAALPGE PSITLDPLRT       120
     DRLDACEALT PFMPSGMRVR ARMTVGLRCV APRTWTVYAQ ATVSVPGQYY VAARQIAPGK       180
     TIEAADLTTR DGDLVALPPG VITDAAAILG MRPAHRIAAG QPIKGAGLRS AESVSRGQSV       240
     RITARGNGFV VSSEGQALDN APPSATVQVR TASGQVVSGI VQAAGLVEIQ L                291
//

If you have problems or comments...

PBIL Back to PBIL home page