(data stored in ACNUC1104 zone)

EMBL: BX640427.FLGB

BX640427.FLGB        Location/Qualifiers
FT   CDS             199138..199545
FT                   /transl_table=11
FT                   /gene="flgB"
FT                   /gene_synonym="flbA"
FT                   /gene_synonym="fla FII"
FT                   /locus_tag="BPP1485"
FT                   /product="flagellar basal-body rod protein FlgB"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1373"
FT                   /db_xref="GOA:Q7WA97"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA97"
FT                   /protein_id="CAE36787.1"
FT                   /translation="MLDRLNEDFRFFQQSIALRAQRQEVLSSNIANADTPNYKARDFDF
FT                   KAAMQGALEQRMRLPDTNLALTSARHIPGQATTPSPAELMYRLPYQPSLDGNTVDMDSE
FT                   RVRFADNTLHYQSSLQVLSGRIRSLMSAIQE"
     MLDRLNEDFR FFQQSIALRA QRQEVLSSNI ANADTPNYKA RDFDFKAAMQ GALEQRMRLP        60
     DTNLALTSAR HIPGQATTPS PAELMYRLPY QPSLDGNTVD MDSERVRFAD NTLHYQSSLQ       120
     VLSGRIRSLM SAIQE                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page