(data stored in ACNUC1104 zone)

EMBL: BX640427.FLGC

BX640427.FLGC        Location/Qualifiers
FT   CDS             199558..199977
FT                   /transl_table=11
FT                   /gene="flgC"
FT                   /gene_synonym="flaW"
FT                   /gene_synonym="fla FIII"
FT                   /locus_tag="BPP1486"
FT                   /product="flagellar basal-body rod protein FlgC"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1374"
FT                   /db_xref="GOA:Q7WA96"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA96"
FT                   /protein_id="CAE36788.1"
FT                   /translation="MSLLSIFEIAGSALSAQSQRMNVSASNMANADSVAGPDGQPYRAR
FT                   QVVFQVNPPPGQAFGQEIGGVRVAGVVEDQSPFKKIYDPKHPMADAQGYVNMPNVDPVA
FT                   ETVNMIAASRSYQANVEVLNTAKQLMLKTLTIGQS"
     MSLLSIFEIA GSALSAQSQR MNVSASNMAN ADSVAGPDGQ PYRARQVVFQ VNPPPGQAFG        60
     QEIGGVRVAG VVEDQSPFKK IYDPKHPMAD AQGYVNMPNV DPVAETVNMI AASRSYQANV       120
     EVLNTAKQLM LKTLTIGQS                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page