(data stored in ACNUC1104 zone)

EMBL: BX640427.FLGD

BX640427.FLGD        Location/Qualifiers
FT   CDS             200025..200729
FT                   /transl_table=11
FT                   /gene="flgD"
FT                   /gene_synonym="flaV"
FT                   /gene_synonym="fla FIV"
FT                   /locus_tag="BPP1487"
FT                   /product="basal-body rod modification protein FlgD"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1375"
FT                   /db_xref="GOA:Q7WA95"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="InterPro:IPR025963"
FT                   /db_xref="InterPro:IPR025965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA95"
FT                   /protein_id="CAE36789.1"
FT                   /translation="MTTVNETTSQAGLALAQAGSNSAAQGIQDQFLTLLVTQLRNQDPL
FT                   NPMENAELTSQLAQISTVEGINNLKNTMLAISGQIDVSQSMDAVSMIGKGVLMPGDKVS
FT                   LGTDPNDPAQRGATPFGIDLQGDATKVTVKVLDPSGAVVRTMELGDLKTGVHTLQWDGN
FT                   NDGGQPLADGKYSITVSASDADANPVKTEALTYGQVKSVAYSTNGLRLDLGLAGQISML
FT                   DVRKVIGASGSA"
     MTTVNETTSQ AGLALAQAGS NSAAQGIQDQ FLTLLVTQLR NQDPLNPMEN AELTSQLAQI        60
     STVEGINNLK NTMLAISGQI DVSQSMDAVS MIGKGVLMPG DKVSLGTDPN DPAQRGATPF       120
     GIDLQGDATK VTVKVLDPSG AVVRTMELGD LKTGVHTLQW DGNNDGGQPL ADGKYSITVS       180
     ASDADANPVK TEALTYGQVK SVAYSTNGLR LDLGLAGQIS MLDVRKVIGA SGSA             234
//

If you have problems or comments...

PBIL Back to PBIL home page