(data stored in ACNUC1104 zone)

EMBL: BX640427.FLGE

BX640427.FLGE        Location/Qualifiers
FT   CDS             200795..202216
FT                   /transl_table=11
FT                   /gene="flgE"
FT                   /gene_synonym="flaK"
FT                   /gene_synonym="fla FV"
FT                   /locus_tag="BPP1488"
FT                   /product="flagellar hook protein FlgE"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1376"
FT                   /db_xref="GOA:Q7WA94"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR011491"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037058"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA94"
FT                   /protein_id="CAE36790.1"
FT                   /translation="MGFGQGLSGLNAASQNLDVIGNNIANSGTVGFKSGAASFADVYAS
FT                   SRVGLGVKVSAINQRFTVGNISTTGGEYDMAIDGGKGFFRLTDQSGGVFYSRNGEFMVD
FT                   KNFYIVNAQGFRLTGYPAGGVGAQPVDLQLPQGNIAPQATSTAGLQTNLNANAKVIDPN
FT                   DTPADDGAVELDGTTYRFTNASGTFAWVAPAPLDGTYNGGDIVIAGGAVTGDLASQPGY
FT                   QPYKPLVAGIPFDPTNPLSYTDQVPTTVYDSLGNSHQMIQYFAKRPAVGTESVYEVYYV
FT                   LDGQPMQVNGGASQTLNFDTAGNLLNQPPTAQVTFANPGGNAAPADPLAITVSYNGVTQ
FT                   YGSDFAPKVVQNGYSSGEFMGLSVGKDGSLVAKYTNGETQTIGTLVLANFNNVQGLQPV
FT                   GNNAWVETSESGQATLGQPGTNGLATIAGQALEASNVDMSRELVNMIVAQRTYQANAQT
FT                   IKTQDEVMQVLMNMR"
     MGFGQGLSGL NAASQNLDVI GNNIANSGTV GFKSGAASFA DVYASSRVGL GVKVSAINQR        60
     FTVGNISTTG GEYDMAIDGG KGFFRLTDQS GGVFYSRNGE FMVDKNFYIV NAQGFRLTGY       120
     PAGGVGAQPV DLQLPQGNIA PQATSTAGLQ TNLNANAKVI DPNDTPADDG AVELDGTTYR       180
     FTNASGTFAW VAPAPLDGTY NGGDIVIAGG AVTGDLASQP GYQPYKPLVA GIPFDPTNPL       240
     SYTDQVPTTV YDSLGNSHQM IQYFAKRPAV GTESVYEVYY VLDGQPMQVN GGASQTLNFD       300
     TAGNLLNQPP TAQVTFANPG GNAAPADPLA ITVSYNGVTQ YGSDFAPKVV QNGYSSGEFM       360
     GLSVGKDGSL VAKYTNGETQ TIGTLVLANF NNVQGLQPVG NNAWVETSES GQATLGQPGT       420
     NGLATIAGQA LEASNVDMSR ELVNMIVAQR TYQANAQTIK TQDEVMQVLM NMR              473
//

If you have problems or comments...

PBIL Back to PBIL home page