(data stored in ACNUC1104 zone)

EMBL: BX640427.FLGF

BX640427.FLGF        Location/Qualifiers
FT   CDS             202255..203019
FT                   /transl_table=11
FT                   /gene="flgF"
FT                   /gene_synonym="flaX"
FT                   /gene_synonym="fla FVI"
FT                   /locus_tag="BPP1489"
FT                   /product="flagellar basal-body rod protein FlgF"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1377"
FT                   /db_xref="GOA:Q7WA93"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA93"
FT                   /protein_id="CAE36791.1"
FT                   /translation="MDRIIYTAMNGAARIAEHQTVLGNNMANVNTPGFREQIALYRSVP
FT                   MADGTSLPTRVSTVASTPGNNFEMGNMMTTGRELDVALAGPGWFALQTPQGEAYTRAGA
FT                   LQVGVNGLLQTATGQPVLSDQNAVIEVPDQASLTIASDGTVTAIGAGDPPNNILNLGRL
FT                   KMVNPPPQQLVHGDDGVFRMPQQPGGQPAAPLPADPSQRLLSGVLEGSNASPMGAMVGM
FT                   IQNARRFEMQMQVIREADKNAERANGILAAAS"
     MDRIIYTAMN GAARIAEHQT VLGNNMANVN TPGFREQIAL YRSVPMADGT SLPTRVSTVA        60
     STPGNNFEMG NMMTTGRELD VALAGPGWFA LQTPQGEAYT RAGALQVGVN GLLQTATGQP       120
     VLSDQNAVIE VPDQASLTIA SDGTVTAIGA GDPPNNILNL GRLKMVNPPP QQLVHGDDGV       180
     FRMPQQPGGQ PAAPLPADPS QRLLSGVLEG SNASPMGAMV GMIQNARRFE MQMQVIREAD       240
     KNAERANGIL AAAS                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page