(data stored in ACNUC1104 zone)

EMBL: BX640427.FLGH

BX640427.FLGH        Location/Qualifiers
FT   CDS             203845..204537
FT                   /transl_table=11
FT                   /gene="flgH"
FT                   /gene_synonym="flaY"
FT                   /gene_synonym="fla FVIII"
FT                   /locus_tag="BPP1491"
FT                   /product="flagellar L-ring protein precursor"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1379"
FT                   /db_xref="GOA:Q7WA92"
FT                   /db_xref="InterPro:IPR000527"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WA92"
FT                   /protein_id="CAE36793.1"
FT                   /translation="MMLKTVLRLPVCAALLALAAGCAMIPPEPVVTGPLTAPPPPPPQP
FT                   SARPNGSIYQPSAYGNYPLFEDRRPRNVGDIVTIVLEEKTNAAKGVATNTSRDGSATLG
FT                   VAAAPRFMDGVINDKLDTDISGGNTANGTGKSSANNTFTGTITTTVIGVLPNGNLQIAG
FT                   EKQIAINRGSEYVRFSGVVDPRSITGSNTVSSTRVADARIEYRSKGVMDEVQTMGWLQR
FT                   FFLIASPF"
     MMLKTVLRLP VCAALLALAA GCAMIPPEPV VTGPLTAPPP PPPQPSARPN GSIYQPSAYG        60
     NYPLFEDRRP RNVGDIVTIV LEEKTNAAKG VATNTSRDGS ATLGVAAAPR FMDGVINDKL       120
     DTDISGGNTA NGTGKSSANN TFTGTITTTV IGVLPNGNLQ IAGEKQIAIN RGSEYVRFSG       180
     VVDPRSITGS NTVSSTRVAD ARIEYRSKGV MDEVQTMGWL QRFFLIASPF                  230
//

If you have problems or comments...

PBIL Back to PBIL home page