(data stored in ACNUC1104 zone)

EMBL: BX640427.FLGK

BX640427.FLGK        Location/Qualifiers
FT   CDS             206780..208426
FT                   /transl_table=11
FT                   /gene="flgK"
FT                   /gene_synonym="flaS"
FT                   /gene_synonym="flaW"
FT                   /locus_tag="BPP1494"
FT                   /product="flagellar hook-associated protein 1"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1382"
FT                   /db_xref="GOA:Q7WA89"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA89"
FT                   /protein_id="CAE36796.1"
FT                   /translation="MNLYNLALTGLNASQAGLETTSHNINNATTVGYSRQRVITSTAGA
FT                   GETGQGFFGRGVQVDTVTRQYDSFLYRQLVGAQGSSAQLSTHLAQVSQVNNLFGDRTVG
FT                   ITPALAGLFTSTNAAATKPADPAVRADMIGKANSLVTQINTAYQELENQRNGLNTQIST
FT                   TVEQVNSYLERINDLNKQIVIARGKDGHAPNDLLDQRDQAVSELNQLTGIRFYEQGDTF
FT                   NITLQSGQTLLSGTTVYPLQAVPSASDPKRLAVAYTLPSGPGTTIQVEMNDSEVTGGQL
FT                   GGLLSFRSQSLDAVQDQLGQLAIGLAMAFNAQHREGYDLDGQPGGDMFGLQAPAAIRNS
FT                   GNTSTGEWQSAYTDADAIRASAYRIQYDGANYTVTRLSDGSSFDVTPSGTPPTLSFDGL
FT                   TLTGSGTPAAGDAWTLQPARDAARDLKQLISDPSKLALADSALGTTNGNNGLKLAELQT
FT                   AKVLGNGSMSLNEMFSQLVNNVGVQTQQVSTANTAQANLVKQQATAHLSVSGVNLNEEY
FT                   VNLTIFQEQYQASAKILDVASTVFDTLLGLR"
     MNLYNLALTG LNASQAGLET TSHNINNATT VGYSRQRVIT STAGAGETGQ GFFGRGVQVD        60
     TVTRQYDSFL YRQLVGAQGS SAQLSTHLAQ VSQVNNLFGD RTVGITPALA GLFTSTNAAA       120
     TKPADPAVRA DMIGKANSLV TQINTAYQEL ENQRNGLNTQ ISTTVEQVNS YLERINDLNK       180
     QIVIARGKDG HAPNDLLDQR DQAVSELNQL TGIRFYEQGD TFNITLQSGQ TLLSGTTVYP       240
     LQAVPSASDP KRLAVAYTLP SGPGTTIQVE MNDSEVTGGQ LGGLLSFRSQ SLDAVQDQLG       300
     QLAIGLAMAF NAQHREGYDL DGQPGGDMFG LQAPAAIRNS GNTSTGEWQS AYTDADAIRA       360
     SAYRIQYDGA NYTVTRLSDG SSFDVTPSGT PPTLSFDGLT LTGSGTPAAG DAWTLQPARD       420
     AARDLKQLIS DPSKLALADS ALGTTNGNNG LKLAELQTAK VLGNGSMSLN EMFSQLVNNV       480
     GVQTQQVSTA NTAQANLVKQ QATAHLSVSG VNLNEEYVNL TIFQEQYQAS AKILDVASTV       540
     FDTLLGLR                                                                548
//

If you have problems or comments...

PBIL Back to PBIL home page