(data stored in ACNUC1104 zone)

EMBL: BX640427.FLIG

BX640427.FLIG        Location/Qualifiers
FT   CDS             complement(222077..223087)
FT                   /transl_table=11
FT                   /gene="fliG"
FT                   /gene_synonym="fla BII"
FT                   /gene_synonym="fla AII.2"
FT                   /locus_tag="BPP1509"
FT                   /product="flagellar motor switch protein FliG"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1402"
FT                   /db_xref="GOA:Q7WA77"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA77"
FT                   /protein_id="CAE36811.1"
FT                   /translation="MKNDGKPLDGMTRSAVLMMSLGEDAAAEVFKYLSAREVQQVGAAM
FT                   ASLKQVTRGDVAVVLEEFRQEADQFMAVTLGSDDYIRTVLTKALGSDRAAGLIEDILEA
FT                   GEGGSGIDALNWLDPHTVAELIGDEHPQIIATILVHLERDRAASVLAMLSERMRNDVML
FT                   RIATFGGVQPAALSELTDVLNSVLAGQGAKRSKMGGVRTAAEILNMMNSSQEEAVVESL
FT                   RERDSDLAQKIIDEMFVFDNLLDVEDRAVQLILKEIDNDTLMVALKGAGDELRNKFLRN
FT                   MSSRAAEMLREDLEAQGPIRMSKVEGEQKKILQIARRLAESGQIVLGTQGDDAYV"
     MKNDGKPLDG MTRSAVLMMS LGEDAAAEVF KYLSAREVQQ VGAAMASLKQ VTRGDVAVVL        60
     EEFRQEADQF MAVTLGSDDY IRTVLTKALG SDRAAGLIED ILEAGEGGSG IDALNWLDPH       120
     TVAELIGDEH PQIIATILVH LERDRAASVL AMLSERMRND VMLRIATFGG VQPAALSELT       180
     DVLNSVLAGQ GAKRSKMGGV RTAAEILNMM NSSQEEAVVE SLRERDSDLA QKIIDEMFVF       240
     DNLLDVEDRA VQLILKEIDN DTLMVALKGA GDELRNKFLR NMSSRAAEML REDLEAQGPI       300
     RMSKVEGEQK KILQIARRLA ESGQIVLGTQ GDDAYV                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page