(data stored in ACNUC1104 zone)

EMBL: BX640427.FLIH

BX640427.FLIH        Location/Qualifiers
FT   CDS             complement(221329..222084)
FT                   /transl_table=11
FT                   /gene="fliH"
FT                   /gene_synonym="fla BIII"
FT                   /gene_synonym="fla AII.3"
FT                   /locus_tag="BPP1508"
FT                   /product="flagellar assembly protein FliH"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1401"
FT                   /db_xref="GOA:Q7WA78"
FT                   /db_xref="InterPro:IPR000563"
FT                   /db_xref="InterPro:IPR018035"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA78"
FT                   /protein_id="CAE36810.1"
FT                   /translation="MSEALAREPAALPRSAAWRRWQMLSFDEPAEAETPEPAALEPEPE
FT                   PAPDPEELLREWRATAERAGHAAGHQAGQEQGQREGYAAGHAQGLAAGRAEGHAEGLAQ
FT                   GREEARQQAERLHALAQACAASVARLEDNMGQSLLTLALDIAGQVLRTALAEHPETMVA
FT                   AVREVLHINPATGAAMRLWVHPDDLELVRTHLADELNEANWRLQADESITRGGCRTETA
FT                   YGDVDATLQARWRRVAASLGRSAAWEETA"
     MSEALAREPA ALPRSAAWRR WQMLSFDEPA EAETPEPAAL EPEPEPAPDP EELLREWRAT        60
     AERAGHAAGH QAGQEQGQRE GYAAGHAQGL AAGRAEGHAE GLAQGREEAR QQAERLHALA       120
     QACAASVARL EDNMGQSLLT LALDIAGQVL RTALAEHPET MVAAVREVLH INPATGAAMR       180
     LWVHPDDLEL VRTHLADELN EANWRLQADE SITRGGCRTE TAYGDVDATL QARWRRVAAS       240
     LGRSAAWEET A                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page