(data stored in ACNUC1104 zone)

EMBL: BX640427.FLIK

BX640427.FLIK        Location/Qualifiers
FT   CDS             complement(218108..219424)
FT                   /transl_table=11
FT                   /gene="fliK"
FT                   /gene_synonym="flaE"
FT                   /gene_synonym="flaR"
FT                   /locus_tag="BPP1505"
FT                   /product="flagellar hook-length control protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1398"
FT                   /db_xref="GOA:Q7WA81"
FT                   /db_xref="InterPro:IPR001635"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="InterPro:IPR038610"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA81"
FT                   /protein_id="CAE36807.1"
FT                   /translation="MSRNRTAAMTTATLPIPALTPAPGPAAQGGPAAAGKGPSFSQVLA
FT                   RQQGGKPGEAGTPAAPGAQAGAPAQGPATQNPAGAGKPGKPGDTAALPVDGQQEPAAET
FT                   AADAATLAALAAQTAPAPALPLQALEIAAEAAAVNAQVAAATQAAGAAARQPAHAALLA
FT                   GQPAAPAAAGAPPADTAPAMPPALPQAAQPAVAAQAAVAASAPNAPAAETAATPPAAPS
FT                   LPHPLPSTGGTPQDGGEAAEPPATAPAQPQPLAAAEHGAALHAAAQAHIAARQAVGNPA
FT                   PASLPAAAQPLGLEVAAPVGSSQWGQDLGRQLVTISHDARQGHHTAELRLDPPDLGPLR
FT                   VSINLHEGVASAAFVSVHAAVRQAVEAALPQLQQALAQAGISLGQTSVGDQSAQQGFAE
FT                   QQGRGAGASGGSAAGADSETVVVAATPARNADALVDTFA"
     MSRNRTAAMT TATLPIPALT PAPGPAAQGG PAAAGKGPSF SQVLARQQGG KPGEAGTPAA        60
     PGAQAGAPAQ GPATQNPAGA GKPGKPGDTA ALPVDGQQEP AAETAADAAT LAALAAQTAP       120
     APALPLQALE IAAEAAAVNA QVAAATQAAG AAARQPAHAA LLAGQPAAPA AAGAPPADTA       180
     PAMPPALPQA AQPAVAAQAA VAASAPNAPA AETAATPPAA PSLPHPLPST GGTPQDGGEA       240
     AEPPATAPAQ PQPLAAAEHG AALHAAAQAH IAARQAVGNP APASLPAAAQ PLGLEVAAPV       300
     GSSQWGQDLG RQLVTISHDA RQGHHTAELR LDPPDLGPLR VSINLHEGVA SAAFVSVHAA       360
     VRQAVEAALP QLQQALAQAG ISLGQTSVGD QSAQQGFAEQ QGRGAGASGG SAAGADSETV       420
     VVAATPARNA DALVDTFA                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page